Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC, corresponding to residues 1097-1196 of mouse KCa 1.1 variant 2 |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
0.6 mg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS, pH 7.4, with 1% BSA |
Contains |
0.05% sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2736008 |
Product is shipped at room temperature as a lyophilized powder and should be stored at -20 °C upon receipt. Reconstitution: add 50 µL of deionized water.
Potassium channels are a group of ubiquitously expressed proteins that serve numerous functions in excitable and non-excitable cells. One class of integral membrane potassium channels is the large conductance, calcium-activated potassium channel (Maxi K+). Maxi K+ differs from most other potassium channels in that its activation is controlled by both increases in intracellular calcium and by membrane depolarization. Maxi K+ dual activation is possible because of its structure. The core of the channel, which is similar to other potassium channels, is a Maxi K+ alpha homotetramer that contains both a voltage sensor and an intracellular calcium binding domain. In vascular smooth muscle, an auxiliary beta-subunit is found in a 1:1 stoichiometry. The beta-subunit exhibits its effect on the Maxi K+ channel by effectively decreasing by 5- to 10- fold the concentration of calcium required to keep the pore open.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: big potassium channel alpha subunit; BK channel; BK channel alpha subunit; BKCA alpha; BKCA alpha subunit; calcium-activated potassium channel alpha subunit; Calcium-activated potassium channel subunit alpha-1; Calcium-activated potassium channel, subfamily M subunit alpha-1; K(VCA)alpha; KCa1.1; Maxi K channel; maxi-K channel HSLO; MaxiK; mSlo1; potassium channel, calcium activated large conductance subfamily M alpha, member 1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; Slo homolog; Slo-alpha; Slo1; Slowpoke homolog; stretch-activated Kca channel
Gene Aliases: 5730414M22Rik; bA205K10.1; BKCa; BKTM; hSlo; KCa1.1; KCNMA; KCNMA1; KCNMA1b; KCNMA1c; MaxiK; mSlo; mSLO1; SAKCA; SLO; SLO-ALPHA; SLO1
UniProt ID: (Human) Q12791, (Mouse) Q08460, (Rat) Q7TQ56
Entrez Gene ID: (Human) 3778, (Mouse) 16531, (Rat) 83731
Molecular Function:
ion channel
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
