Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • KCNQ1 Antibodies

          Invitrogen

          KCNQ1 Polyclonal Antibody

          View all (25) KCNQ1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite KCNQ1 Polyclonal Antibody

          • Antibody Testing Data (8)
          KCNQ1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          KCNQ1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 8

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          KCNQ1 Antibody (PA5-95399) in ICC/IF

          Immunocytochemistry analysis of KCNQ1 using anti-KCNQ1 antibody (Product # PA5-95399) . KCNQ1 was detected in an immunocytochemical section of HeLa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-KCNQ1 antibody (Product # PA5-95399) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counte... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          KCNQ1 Antibody in Immunocytochemistry (ICC/IF)
          KCNQ1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KCNQ1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KCNQ1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KCNQ1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          KCNQ1 Antibody in Western Blot (WB)
          KCNQ1 Antibody in Flow Cytometry (Flow)
          KCNQ1 Antibody in Flow Cytometry (Flow)
          KCNQ1 Polyclonal Antibody

          Product Details

          PA5-95399

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807202

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human THP-1 whole cell, rat stomach tissue, rat lung tissue, rat PC-12 whole cell, mouse stomach tissue, mouse lung tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human lung cancer tissue, human placenta tissue, human breast cancer tissue. ICC/IF: Hela cell. Flow: U937 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. A specific K+ channel, comprised of an alpha subunit KCNQ1 and a beta subunit KCNE1, a small protein which spans the membrane only once, is predominantly expressed in the heart and in the cochlea, and is responsible for regulating the slow, depolarization-activated potassium current. Mutations in the genes encoding for KCNQ1 and KCNE1 lead to cardiac disease because they directly impair electrical signaling, and mutations in KCNQ4 are implicated in the onset of deafness. KCNQ proteins, including KCNQ1 and KCNQ4, characteristically contain six transmembrane domains and function as tetramers. KCNQ4 forms heteromeric channels with KCNQ3 and is expressed in several tissues, including the cochlea, where it is present in outer hair cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: FLJ26167; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; kidney and cardiac voltage dependend K+ channel; KQT-like 1; potassium channel, voltage gated KQT-like subfamily Q, member 1; Potassium voltage-gated channel subfamily KQT member 1; potassium voltage-gated channel, KQT-like subfamily, member 1; potassium voltage-gated channel, subfamily Q, member 1; slow delayed rectifier channel subunit; Voltage-gated potassium channel subunit Kv7.1

          View more View less

          Gene Aliases: ATFB1; ATFB3; AW559127; JLNS1; KCNA8; KCNA9; KCNQ1; Kv1.9; Kv7.1; KVLQT1; LQT; LQT1; RWS; SQT2; WRS

          View more View less

          UniProt ID: (Human) P51787, (Mouse) P97414, (Rat) Q9Z0N7

          View more View less

          Entrez Gene ID: (Human) 3784, (Mouse) 16535, (Rat) 84020

          View more View less

          Function(s)
          voltage-gated potassium channel activity delayed rectifier potassium channel activity protein binding calmodulin binding phosphatidylinositol-4,5-bisphosphate binding protein phosphatase 1 binding outward rectifier potassium channel activity protein kinase A catalytic subunit binding protein kinase A regulatory subunit binding ion channel binding voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization scaffold protein binding voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization ion channel activity voltage-gated ion channel activity potassium channel activity protein homodimerization activity voltage-gated ion channel
          Process(es)
          positive regulation of defense response to virus by host regulation of gene expression by genetic imprinting sensory perception of sound regulation of heart contraction positive regulation of heart rate gene silencing cellular response to drug inner ear development intestinal absorption cardiac muscle contraction regulation of membrane repolarization regulation of ventricular cardiac muscle cell membrane repolarization regulation of atrial cardiac muscle cell membrane repolarization positive regulation of cardiac muscle contraction regulation of gastric acid secretion cardiac conduction renal absorption cellular response to cAMP potassium ion export potassium ion transmembrane transport cellular response to epinephrine stimulus cardiovascular system development ventricular cardiac muscle cell action potential membrane repolarization during action potential membrane repolarization during cardiac muscle cell action potential atrial cardiac muscle cell action potential regulation of heart rate by cardiac conduction potassium ion export across plasma membrane xenophagy membrane repolarization during ventricular cardiac muscle cell action potential positive regulation of potassium ion transmembrane transport transport ion transport potassium ion transport regulation of ion transmembrane transport regulation of membrane potential negative regulation of insulin secretion transmembrane transport positive regulation of gastric acid secretion response to anesthetic male gonad development
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-mkbj4:80/100.66.76.99:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline