Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • Ku70 Antibodies

          Invitrogen

          Ku70 Polyclonal Antibody

          View all (34) Ku70 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Ku70 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (18)
          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 18

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Ku70 Antibody (PA5-95270) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of Ku70 in U2OS cell using Ku70 Polyclonal Antibody (Product # PA5-95270). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL and mouse anti-Beta Tubulin antibody overnight at 4°C. Cy3 conjugated goat anti-rabbit IgG and FITC conjugated goat anti-mouse IgG were used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. Visualized usi... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Western Blot (WB)
          Ku70 Antibody in Flow Cytometry (Flow)
          Ku70 Polyclonal Antibody

          Product Details

          PA5-95270

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807074

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human LNCAP whole cell, human Hela whole cell, human 293T whole cell, human HepG2 whole cell, human Jurkat whole cell, human K562 whole cell, human A549 whole cell, human A431 whole cell. IHC: human bladder cancer tissue, human bladder cancer tissue, human colon adenocarcinoma tissue, human colon adenocarcinoma tissue, human glioblastoma tissue, human glioblastoma tissue, human liver cancer tissue, human liver cancer tissue, human lung adenocarcinoma tissue, human lung adenocarcinoma tissue, human pancreas ductal adenocarcinoma tissue, human pancreas ductal adenocarcinoma tissue, human testicular seminoma tissue, human testicular seminoma tissue. ICC/IF: U2OS cell. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; DNA repair protein Ku70; DNA repair protein XRCC6; G22P1; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; Ku protein subunit; Ku70; Lupus Ku autoantigen protein p70; OTTHUMP00000028581; p70 autoantigen; thyroid autoantigen; thyroid autoantigen 70kD (Ku antigen); thyroid autoantigen 70kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; unnamed protein product; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair cross-complementing protein 6

          View more View less

          Gene Aliases: CTC75; CTCBF; G22P1; KU70; ML8; TLAA; XRCC6

          View more View less

          UniProt ID: (Human) P12956

          View more View less

          Entrez Gene ID: (Human) 2547

          View more View less

          Function(s)
          nucleotide binding transcription regulatory region sequence-specific DNA binding DNA binding DNA helicase activity damaged DNA binding double-stranded DNA binding double-stranded telomeric DNA binding RNA binding catalytic activity helicase activity protein binding ATP binding DNA-dependent ATPase activity hydrolase activity lyase activity ATPase activity cyclin binding telomeric DNA binding macromolecular complex binding DNA end binding 5'-deoxyribose-5-phosphate lyase activity scaffold protein binding
          Process(es)
          telomere maintenance recombinational repair activation of innate immune response immune system process positive regulation of immune system process DNA repair double-strand break repair via nonhomologous end joining DNA recombination cellular response to DNA damage stimulus response to ionizing radiation negative regulation of macromolecule biosynthetic process innate immune response positive regulation of lymphocyte differentiation positive regulation of protein kinase activity negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter regulation of smooth muscle cell proliferation cellular hyperosmotic salinity response cellular response to gamma radiation cellular response to X-ray double-strand break repair via classical nonhomologous end joining
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-pgj68:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline