Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
MA5-11507 targets pS2/pNR-2 Estrogen-Regulated Protein in IHC applications and shows reactivity with Human samples.
The MA5-11507 immunogen is a Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein.
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; estrogen receptor; gastrointestinal trefoil protein pS2; hP1.A; PNR-2; Polypeptide P1.A; Protein pS2; Trefoil factor 1; unnamed protein product
Gene Aliases: BCEI; D21S21; HP1.A; HPS2; pNR-2; PS2; TFF1
UniProt ID: (Human) P04155
Entrez Gene ID: (Human) 7031
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support