Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • TFF1 Antibodies
          The product (cat # {{productObj.productId}}) that you're looking for is temporarily unavailable. A suggested replacement is cat # {{productObj.replacementProductId}}. Please contact Technical Support for other suitable replacement options.

          Invitrogen

          TFF1 Monoclonal Antibody (pS2.1)

          1 Reference
          View all (61) TFF1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite TFF1 Monoclonal Antibody (pS2.1)

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          TFF1 Monoclonal Antibody (pS2.1)

          Product Details

          MA5-11507

          Applications
          Tested Dilution
          Publications

          Immunohistochemistry (IHC)

          Assay-dependent
          -

          Immunocytochemistry (ICC/IF)

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human

          Published species

          Human

          Host/Isotype

          Mouse / IgG1

          Class

          Monoclonal

          Type

          Antibody

          Clone

          pS2.1

          Immunogen

          A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          0.2 mg/mL

          Amount

          100 µg

          Purification

          Protein G

          Storage buffer

          PBS, pH 7.4, with 0.2% BSA

          Contains

          0.09% sodium azide

          Storage conditions

          4°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_10985386

          Product Specific Information

          MA5-11507 targets pS2/pNR-2 Estrogen-Regulated Protein in IHC applications and shows reactivity with Human samples.

          The MA5-11507 immunogen is a Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein.

          Target Information

          Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: Breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; estrogen receptor; gastrointestinal trefoil protein pS2; hP1.A; PNR-2; Polypeptide P1.A; Protein pS2; Trefoil factor 1; unnamed protein product

          View more View less

          Gene Aliases: BCEI; D21S21; HP1.A; HPS2; pNR-2; PS2; TFF1

          View more View less

          UniProt ID: (Human) P04155

          View more View less

          Entrez Gene ID: (Human) 7031

          View more View less

          Function(s)
          protein binding growth factor activity
          Process(es)
          carbohydrate metabolic process signal transduction cell proliferation negative regulation of cell proliferation response to iron ion cell differentiation maintenance of gastrointestinal epithelium response to immobilization stress response to peptide hormone
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-nrcn4:80/100.66.78.247:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline