Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Non-human primate |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13, different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807204 |
Synthetic peptide sequence: 109-154aa, RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
MMP13 (collagense 3) plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC, and ACAN. MMP13 cleaves tripal helical collagens, including type I, II, and III collagen - but has the highest activity with soluble type II collagen. It can degrade collagen type IV, XIV, and X. MMP13 plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization, and ossification. It is required for normal embryonic bone development and ossificaiton. Mutations affecting the gene can lead to spondyloepimetaphyseal dysplasia Missouri type, metaphyseal anadysplasia 1, and metaphyseal dysplasia Sphar type.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Collagenase; Collagenase 3; Collagenase3; matrix metallo protease; matrix metalloproteinase 13 (collagenase 3); Matrix metalloproteinase-13; MMP; MMP-13; MMPs; Procollagenase 3
Gene Aliases: CLG3; MANDP1; MMP-13; MMP13
UniProt ID: (Human) P45452
Entrez Gene ID: (Human) 4322
Molecular Function:
metalloprotease
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support