Search
Invitrogen
MMP3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 2
MMP3 Antibody (PA5-79683) in WB
Western blot analysis of MMP3 in Lane 1: human placenta tissue lysate, Lane 2: U20S whole cell lysate, Lane 3: HeLa whole cell lysate, Lane 4: PANC whole cell lysate, Lane 5: COLO320 whole cell lysate using 40-50 µg per well. Sample was incubated with MMP3 (Product # PA5-79683) at a dilution of 0.5 µg/mL.
Product Details
PA5-79683
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3 (410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Human Placenta Tissue, U20S whole cell, HELA whole cell, PANC whole cell, COLO320 whole cell.
Target Information
MMP3 (stromelysin-1) belongs to the peptidase M10A subfamily. It is secreted in its pro-protein form, and is activated by extracellular proteinase cleavage. MMP3 is capable of binding to zinc and calcium ions, and has metallo-endopeptidase activity. The active enzyme degrades collagen, gelatin, fibronectin, and laminin. It is involved in normal cellular processes such as wound repair and tissue remodeling. Mutations in the gene can result in coronary heart disease 6.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EC 3.4.24.17; matrix metallo protease; matrix metalloproteinase 3 (stromelysin 1, progelatinase); Matrix metalloproteinase-3; MMP; MMP-3; MMPs; proteoglycanase; SL-1; Stromelysin-1; Stromelysin1; Transin-1; Transin1; unnamed protein product
Gene Aliases: CHDS6; MMP-3; MMP3; SL-1; STMY; STMY1; STR1
UniProt ID: (Human) P08254
Entrez Gene ID: (Human) 4314
immune system process
proteolysis
extracellular matrix disassembly
protein catabolic process
extracellular matrix organization
regulation of cell migration
collagen catabolic process
positive regulation of protein complex assembly
cellular response to reactive oxygen species
innate immune response
negative regulation of protein kinase B signaling
cellular response to lipopolysaccharide
cellular response to amino acid stimulus
cellular response to UV-A
cellular response to nitric oxide
regulation of neuroinflammatory response
response to amyloid-beta
negative regulation of reactive oxygen species metabolic process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support