Search
Invitrogen
MYPT1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 11
MYPT1 Antibody (PA5-79857) in ICC/IF
Immunofluorescent analysis of MYPT1 on U251 cells. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with MYPT1 polyclonal antibody (Product# PA5-79857) with a dilution of 2 µg/mL (overnight at 4°C). Development was performed using Streptavidin-Biotin-Complex (SABC) with DAB chromogen method.
Product Details
PA5-79857
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HELA whole cell, human Jurkat whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human Raji whole cell, human K562 whole cell, human CACO-2 whole cell, human HEPG2 whole cell, rat brain tissue, rat lung tissue, rat liver tissue, rat C6 whole cell, mouse brain tissue, mouse lung tissue, mouse liver tissue, mouse NIH/3T3 whole cell. IHC: Human Glioma tissue. ICC/IF: SiHa cell, U251 cell, U251 cell, U251 cell, U251 cell. Flow: Hela cell, SiHa cell, U251 cell.
Target Information
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP. RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MBSP; myosin binding subunit; Myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; Myosin phosphatase-targeting subunit 1; PP-1M; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; Protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; Serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; smooth muscle myosin phosphatase myosin-binding subunit; unnamed protein product
Gene Aliases: 1200015F06Rik; 5730577I22Rik; AA792106; AV099298; D10Ertd625e; GUBS; M110; M130; MBS; MBSP; MYPT1; PPP1R12A
UniProt ID: (Human) O14974, (Rat) Q10728, (Mouse) Q9DBR7
Entrez Gene ID: (Human) 4659, (Rat) 116670, (Mouse) 17931
mitotic cell cycle
protein dephosphorylation
centrosome cycle
signal transduction
regulation of cell adhesion
negative regulation of catalytic activity
positive regulation of transcription from RNA polymerase II promoter
regulation of nucleocytoplasmic transport
neuron projection morphogenesis
cellular response to xenobiotic stimulus
regulation of establishment of endothelial barrier
mitotic nuclear division
regulation of myosin-light-chain-phosphatase activity
centrosome organization
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support