Search
Invitrogen
NONO Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 18
NONO Antibody (PA5-79748) in ICC/IF
Immunocytochemistry analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (Product # PA5-79748) . nmt55/p54nrb was detected in a section of SKOV-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-nmt55/p54nrb antibody (Product # PA5-79748) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section w... View More
Product Details
PA5-79748
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue. IHC: mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue. ICC/IF: U20S cell, SKOV-3 cell. Flow: HELA cell.
Target Information
This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA-binding p52/p100 complex, 52 kDa subunit; HGNC:7871; NMT-1; NMT55; non-POU domain-containing octamer (ATGCAAAT) binding protein; Non-POU domain-containing octamer-binding protein; non-POU-domain-containing; non-POU-domain-containing, octamer-binding protein; NONO; NonO protein; p54(nrb); protein phosphatase 1, regulatory subunit 114; sequence is expressed in human Tera-2 clone 13 (embryonal carcinoma) cells. The sequence may contain mismatches (one strand sequenced only once). 97% identical in 320 bp overlap with human 54 kDA prot; ORF; unnamed protein product
Gene Aliases: AA407051; AV149256; MRXS34; NMT55; nonA; NONO; NRB54; P54; P54NRB; PPP1R114
UniProt ID: (Human) Q15233, (Mouse) Q99K48, (Rat) Q5FVM4
Entrez Gene ID: (Human) 4841, (Mouse) 53610, (Rat) 317259
activation of innate immune response
immune system process
DNA repair
DNA recombination
regulation of transcription, DNA-templated
mRNA processing
cellular response to DNA damage stimulus
circadian rhythm
RNA splicing
regulation of circadian rhythm
negative regulation of apoptotic process
innate immune response
negative regulation of transcription, DNA-templated
rhythmic process
cellular response to hypoxia
negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
cellular response to angiotensin
transcription, DNA-templated
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support