Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • NONO Antibodies

          Invitrogen

          NONO Polyclonal Antibody

          Advanced Verification
          View all (38) NONO antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite NONO Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (16)
          • Advanced Verification (2)
          NONO Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          NONO Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 18

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          NONO Antibody (PA5-79748) in ICC/IF

          Immunocytochemistry analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (Product # PA5-79748) . nmt55/p54nrb was detected in a section of SKOV-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-nmt55/p54nrb antibody (Product # PA5-79748) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section w... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          NONO Antibody in Immunocytochemistry (ICC/IF)
          NONO Antibody in Immunocytochemistry (ICC/IF)
          NONO Antibody in Immunocytochemistry (ICC/IF)
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          NONO Antibody in Western Blot (WB)
          NONO Antibody in Western Blot (WB)
          NONO Antibody in Western Blot (WB)
          NONO Antibody in Western Blot (WB)
          NONO Antibody in Flow Cytometry (Flow)
          NONO Antibody in Flow Cytometry (Flow)
          NONO Antibody
          NONO Antibody
          NONO Polyclonal Antibody

          Product Details

          PA5-79748

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746863

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue. IHC: mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue. ICC/IF: U20S cell, SKOV-3 cell. Flow: HELA cell.

          Target Information

          This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA-binding p52/p100 complex, 52 kDa subunit; HGNC:7871; NMT-1; NMT55; non-POU domain-containing octamer (ATGCAAAT) binding protein; Non-POU domain-containing octamer-binding protein; non-POU-domain-containing; non-POU-domain-containing, octamer-binding protein; NONO; NonO protein; p54(nrb); protein phosphatase 1, regulatory subunit 114; sequence is expressed in human Tera-2 clone 13 (embryonal carcinoma) cells. The sequence may contain mismatches (one strand sequenced only once). 97% identical in 320 bp overlap with human 54 kDA prot; ORF; unnamed protein product

          View more View less

          Gene Aliases: AA407051; AV149256; MRXS34; NMT55; nonA; NONO; NRB54; P54; P54NRB; PPP1R114

          View more View less

          UniProt ID: (Human) Q15233, (Mouse) Q99K48, (Rat) Q5FVM4

          View more View less

          Entrez Gene ID: (Human) 4841, (Mouse) 53610, (Rat) 317259

          View more View less

          Function(s)
          nucleic acid binding DNA binding chromatin binding RNA binding protein binding identical protein binding lncRNA binding nucleotide binding core promoter binding poly(A) RNA binding RNA metabolism protein
          Process(es)
          activation of innate immune response immune system process DNA repair DNA recombination regulation of transcription, DNA-templated mRNA processing cellular response to DNA damage stimulus circadian rhythm RNA splicing regulation of circadian rhythm negative regulation of apoptotic process innate immune response negative regulation of transcription, DNA-templated rhythmic process cellular response to hypoxia negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway cellular response to angiotensin transcription, DNA-templated
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline