Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • NOTCH1 Antibodies

          Invitrogen

          NOTCH1 Polyclonal Antibody

          View all (59) NOTCH1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite NOTCH1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          NOTCH1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          NOTCH1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          NOTCH1 Antibody (PA5-95461) in WB

          Western blot analysis of NOTCH1 in Lane 1: mouse skeletal muscle tissue lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with NOTCH1 polyclonal antibody (Product # PA5-95461) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          NOTCH1 Antibody in Western Blot (WB)
          NOTCH1 Polyclonal Antibody

          Product Details

          PA5-95461

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human Notch1 (1797-1827aa LKNASDGALMDDNQNEWGDEDLETKKFRFEE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807264

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: mouse skeletal muscle tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          The notch gene belongs to a family of epidermal growth factor (EGF) like homeotic genes, which encode transmembrane proteins with a variable number of cysteine-rich EGF-like repeats in the extracellular region. Four notch genes have been described in mammals: Notch1, Notch2, Notch3 and Notch4(Int-3), which have been implicated in the differentiation of the nervous system and other structures. The EGF-like proteins Delta and Serrate have been identified as ligands of Notch1. Mature Notch proteins are heterodimeric receptors derived from the cleavage of Notch pre-proteins into an extracellular subunit (NEC) containing multiple EGF-like repeats and a transmembrane subunit including intracellular region (Ntm).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: major type A protein; Motch A; mT14; Neurogenic locus notch homolog protein 1; Notch 1; Notch gene homolog 1; Notch homolog 1, translocation-associated; NOTCH1; p300; RP23-306D20.12; RP23-306D20.12-001; TAN1; Translocation-associated notch protein TAN-1; transmembrane receptor Notch1; unnamed protein product

          View more View less

          Gene Aliases: 9930111A19Rik; AOS5; AOVD1; hN1; lin-12; Mis6; Motch; N1; NOTCH1; TAN1

          View more View less

          UniProt ID: (Human) P46531, (Mouse) Q01705

          View more View less

          Entrez Gene ID: (Human) 4851, (Mouse) 18128

          View more View less

          Function(s)
          chromatin binding transcription coactivator activity enzyme inhibitor activity transmembrane signaling receptor activity Notch binding calcium ion binding protein binding enzyme binding chromatin DNA binding signaling receptor activity identical protein binding metal ion binding transcription regulator activator activity core promoter binding transcriptional activator activity, RNA polymerase II transcription factor binding transcription factor activity, sequence-specific DNA binding receptor activity sequence-specific DNA binding protein heterodimerization activity
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter angiogenesis in utero embryonic development cell fate specification epithelial to mesenchymal transition liver development heart looping sprouting angiogenesis osteoblast fate commitment positive regulation of neuroblast proliferation inflammatory response to antigenic stimulus endocardium development endocardium morphogenesis atrioventricular node development coronary vein morphogenesis aortic valve morphogenesis atrioventricular valve morphogenesis pulmonary valve morphogenesis mitral valve formation epithelial to mesenchymal transition involved in endocardial cushion formation endocardial cushion morphogenesis cardiac chamber formation cardiac ventricle morphogenesis cardiac atrium morphogenesis cardiac right atrium morphogenesis cardiac left ventricle morphogenesis cardiac right ventricle formation ventricular trabecula myocardium morphogenesis growth involved in heart morphogenesis regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation regulation of cardioblast proliferation Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation cell migration involved in endocardial cushion formation pericardium morphogenesis transcription, DNA-templated regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter transcription from RNA polymerase II promoter humoral immune response Notch signaling pathway positive regulation of transcription of Notch receptor target multicellular organism development spermatogenesis determination of left/right symmetry compartment pattern specification axonogenesis foregut morphogenesis endoderm development heart development positive regulation of cell proliferation negative regulation of cell proliferation epidermis development regulation of Notch signaling pathway auditory receptor cell fate commitment glial cell differentiation regulation of gene expression positive regulation of epithelial to mesenchymal transition negative regulation of cell-substrate adhesion negative regulation of myotube differentiation mesenchymal cell development regulation of somitogenesis neural tube development cell differentiation neuron differentiation keratinocyte differentiation negative regulation of ossification lung development embryonic limb morphogenesis regulation of cell migration positive regulation of cell migration positive regulation of BMP signaling pathway negative regulation of BMP signaling pathway forebrain development hair follicle morphogenesis response to muramyl dipeptide embryonic hindlimb morphogenesis tube formation skeletal muscle cell differentiation cellular response to vascular endothelial growth factor stimulus regulation of cell proliferation anagen positive regulation of apoptotic process negative regulation of catalytic activity cell fate commitment negative regulation of cell differentiation positive regulation of endothelial cell differentiation regulation of auditory receptor cell differentiation negative regulation of auditory receptor cell differentiation positive regulation of keratinocyte differentiation negative regulation of myoblast differentiation negative regulation of neuron differentiation negative regulation of osteoblast differentiation positive regulation of glial cell differentiation positive regulation of Notch signaling pathway negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of calcium ion-dependent exocytosis positive regulation of JAK-STAT cascade negative regulation of photoreceptor cell differentiation somatic stem cell division neuron fate commitment astrocyte differentiation positive regulation of astrocyte differentiation negative regulation of oligodendrocyte differentiation branching morphogenesis of an epithelial tube regulation of epithelial cell proliferation positive regulation of epithelial cell proliferation regulation of neurogenesis negative regulation of neurogenesis regulation of developmental process cardiac muscle tissue morphogenesis cardiac muscle cell proliferation positive regulation of cardiac muscle cell proliferation negative regulation of glial cell proliferation cardiac epithelial to mesenchymal transition cardiac septum morphogenesis ventricular septum morphogenesis secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development negative regulation of cell death prostate gland epithelium morphogenesis regulation of epithelial cell proliferation involved in prostate gland development arterial endothelial cell differentiation venous endothelial cell differentiation cardiac vascular smooth muscle cell development endocardial cell differentiation vasculogenesis involved in coronary vascular morphogenesis coronary artery morphogenesis Notch signaling involved in heart development regulation of cell adhesion involved in heart morphogenesis heart trabecula morphogenesis positive regulation of transcription from RNA polymerase II promoter in response to hypoxia left/right axis specification cellular response to follicle-stimulating hormone stimulus interleukin-4 secretion negative regulation of cell migration involved in sprouting angiogenesis negative regulation of canonical Wnt signaling pathway positive regulation of ephrin receptor signaling pathway regulation of extracellular matrix assembly apoptotic process involved in embryonic digit morphogenesis negative regulation of stem cell differentiation negative regulation of anoikis negative regulation of pro-B cell differentiation negative regulation of endothelial cell chemotaxis luteolysis inhibition of neuroepithelial cell differentiation outflow tract morphogenesis coronary sinus valve morphogenesis endocardial cushion development negative regulation of cell proliferation involved in heart valve morphogenesis negative regulation of extracellular matrix constituent secretion protein import into nucleus apoptotic process immune response axon guidance cell proliferation epidermal cell fate specification gene expression negative regulation of cardiac muscle hypertrophy positive regulation of gene expression negative regulation of gene expression negative regulation of cardiac muscle cell apoptotic process calcium ion regulated exocytosis cell differentiation in spinal cord central nervous system neuron differentiation protein catabolic process organ regeneration response to lipopolysaccharide negative regulation of collagen biosynthetic process tissue regeneration retinal cone cell differentiation negative regulation of programmed cell death positive regulation of viral genome replication positive regulation of Ras protein signal transduction oligodendrocyte differentiation venous blood vessel morphogenesis homeostasis of number of cells within a tissue epithelial cell proliferation negative regulation of epithelial cell proliferation positive regulation of smooth muscle cell differentiation cilium morphogenesis negative regulation of cell adhesion molecule production cardiac muscle cell myoblast differentiation neuroendocrine cell differentiation positive regulation of cardiac epithelial to mesenchymal transition negative regulation of biomineral tissue development positive regulation of ERK1 and ERK2 cascade cellular response to tumor cell cellular response to hypoxia distal tubule development collecting duct development regulation of stem cell proliferation glomerular mesangial cell development epithelial cell fate commitment T-helper 17 type immune response neuronal stem cell population maintenance interleukin-17-mediated signaling pathway chemical synaptic transmission, postsynaptic negative regulation of cold-induced thermogenesis positive regulation of apoptotic process involved in morphogenesis positive regulation of aorta morphogenesis negative regulation of cell-cell adhesion mediated by cadherin
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline