Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • RAD51 Antibodies

          Invitrogen

          RAD51 Polyclonal Antibody

          View all (47) RAD51 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite RAD51 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (8)
          RAD51 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          RAD51 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 8

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RAD51 Antibody (PA5-95579) in ICC/IF

          Immunocytochemistry analysis of Rad51 using anti-Rad51 antibody (Product # PA5-95579) . Rad51 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Rad51 antibody (Product # PA5-95579) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RAD51 Antibody in Immunocytochemistry (ICC/IF)
          RAD51 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAD51 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAD51 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAD51 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAD51 Antibody in Western Blot (WB)
          RAD51 Antibody in Western Blot (WB)
          RAD51 Antibody in Flow Cytometry (Flow)
          RAD51 Polyclonal Antibody

          Product Details

          PA5-95579

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807381

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human A431 whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, human A549 whole cell, human Caco-2 whole cell, rat testis tissue, mouse testis tissue, mouse thymus tissue. IHC: human placenta tissue, human testis tissue, mouse brain tissue, rat brain tissue. ICC/IF: U20S cell. Flow: SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BRCA1/BRCA2-containing complex, subunit 5; DNA repair protein RAD51 homolog 1; HsRAD51; RAD51; RAD51 homolog; RAD51 homolog A; RecA, E. coli, homolog of; RecA-like protein; recombination protein A; unnamed protein product

          View more View less

          Gene Aliases: AV304093; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51; RAD51A; RECA; RGD1563603

          View more View less

          UniProt ID: (Human) Q06609, (Mouse) Q08297

          View more View less

          Entrez Gene ID: (Human) 5888, (Mouse) 19361, (Rat) 499870

          View more View less

          Function(s)
          recombinase activity nucleotide binding DNA binding chromatin binding double-stranded DNA binding single-stranded DNA binding protein binding ATP binding DNA-dependent ATPase activity single-stranded DNA-dependent ATP-dependent DNA helicase activity enzyme binding identical protein binding DNA polymerase binding ATP-dependent DNA damage sensor activity damaged DNA binding protein C-terminus binding single-stranded DNA-dependent ATPase activity molecular_function DNA metabolism protein
          Process(es)
          telomere maintenance via recombination double-strand break repair via homologous recombination DNA recombinase assembly DNA metabolic process DNA repair DNA recombination mitotic recombination cellular response to DNA damage stimulus meiosis I reciprocal meiotic recombination response to xenobiotic stimulus response to toxic substance response to X-ray regulation of double-strand break repair via homologous recombination telomere maintenance via telomere lengthening replication fork processing telomere organization interstrand cross-link repair strand invasion meiotic cell cycle chromosome organization involved in meiotic cell cycle cellular response to alkaloid cellular response to ionizing radiation cellular response to gamma radiation cellular response to hydroxyurea cellular response to cisplatin cellular response to camptothecin response to glucoside replication-born double-strand break repair via sister chromatid exchange mitotic recombination-dependent replication fork processing double-strand break repair involved in meiotic recombination regulation of DNA damage checkpoint regulation of protein phosphorylation DNA unwinding involved in DNA replication meiotic nuclear division positive regulation of DNA ligation protein homooligomerization response to drug
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-5wn4c:80/100.66.76.150:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline