Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human RAB6A. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807330 |
Synthetic peptide sequence: RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Rab proteins are also an integral part of endocytic pathways. Rab 6A is a ubiquitously expressed member of the Rab family of proteins and localizes to the Golgi membrane where it regulates retrograde transport from the late endosomes via the Golgi to endoplasmic reticulum (ER) pathway. Three isoforms exist due to alternative splicing events, namely the ubiquitously expressed isoforms Rab 6A' and Rab 6A, and the brain-specific isoform Rab 6B.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Rab GTPase; Rab-6; RAB6, member RAS oncogene family; RAB6B, member RAS oncogene family; Ras-related protein Rab-6A
Gene Aliases: 2610028L11Rik; AA419671; MNCb-1660; RAB6; RAB6A; Rab6b; RCO4-3
UniProt ID: (Human) P20340, (Rat) Q9WVB1, (Mouse) P35279
Entrez Gene ID: (Human) 5870, (Rat) 84379, (Mouse) 19346
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support