Search
Invitrogen
RAB6A Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 3
RAB6A Antibody (PA5-95528) in IHC (P)
Immunohistochemical analysis of RAB6A in paraffin-embedded section of rat small intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-RAB6A antibody (Product # PA5-95528) overnight at 4°C. Biotinylated goat anti-rabbit I... View More
Product Details
PA5-95528
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human MDA-MB-453 whole cell, human SK-OV-3 whole cell, Human A431 whole cell, rat testis tissue, mouse brain tissue, mouse HEPA1-6 whole cell. IHC: human placenta tissue, rat small intestine tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Rab proteins are also an integral part of endocytic pathways. Rab 6A is a ubiquitously expressed member of the Rab family of proteins and localizes to the Golgi membrane where it regulates retrograde transport from the late endosomes via the Golgi to endoplasmic reticulum (ER) pathway. Three isoforms exist due to alternative splicing events, namely the ubiquitously expressed isoforms Rab 6A' and Rab 6A, and the brain-specific isoform Rab 6B.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: GTPase; Rab GTPase; Rab-6; RAB6, member RAS oncogene family; RAB6A; RAB6A'; RAB6B, member RAS oncogene family; Ras-related protein Rab-6A; transporter; unnamed protein product
Gene Aliases: 2610028L11Rik; AA419671; MNCb-1660; RAB6; RAB6A; Rab6b; RCO4-3
UniProt ID: (Human) P20340, (Rat) Q9WVB1, (Mouse) P35279
Entrez Gene ID: (Human) 5870, (Rat) 84379, (Mouse) 19346
protein targeting to Golgi
intracellular protein transport
retrograde vesicle-mediated transport, Golgi to ER
intra-Golgi vesicle-mediated transport
metabolic process
peptidyl-cysteine methylation
antigen processing and presentation
Rab protein signal transduction
positive regulation of ATPase activity
protein localization to Golgi apparatus
early endosome to Golgi transport
retrograde transport, endosome to Golgi
Golgi vesicle transport
transport
small GTPase mediated signal transduction
protein transport
vesicle-mediated transport
neuron projection development
minus-end-directed organelle transport along microtubule
protein localization to Golgi membrane
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support