Invitrogen

RAGE Polyclonal Antibody

Advanced Verification

This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.

View all (28) RAGE antibodies

Questions & Answers

Tech Support

Questions & Answers

Tech Support

Product Image Gallery

RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of RAGE on paraffin-embedded human intestinal cancer tissue. Sample was incubated with RAGE polyclonal antibody (Product# PA5-78736).

RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of RAGE on paraffin-embedded mouse lung tissue. Sample was incubated with RAGE polyclonal antibody (Product# PA5-78736).

RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of RAGE on paraffin-embedded rat lung tissue. Sample was incubated with RAGE polyclonal antibody (Product# PA5-78736).

RAGE Antibody in Western Blot (WB) — Western blot was performed using Anti-RAGE Polyclonal Antibody (Product # PA5-78736) and 45, 55 kDa bands corresponding to RAGE was observed in Mouse Lung, Rat Lung but less in Mouse Brain, Mouse Cerebellum which are reported to have low expression. Tissue extracts (30 µg lysate) of Mouse Lung (Lane 1), Rat Lung (Lane 2), Mouse Brain (Lane 3) and Mouse Cerebellum (Lane 4) were electrophoresed using Novex® NuPAGE® 4-12 % Bis-Tris gel (Product # NP0321BOX). Resolved proteins were then transferred onto a nitrocellulose membrane (Product # IB23001) by iBlot® 2 Dry Blotting System (Product # IB21001). The blot was probed with the primary antibody (0.5 ug/mL) and detected by and Goat anti-Rabbit IgG (H+L) Superclonal™ Recombinant Secondary Antibody, HRP (Product # A27036, 1:4000 dilution) using the iBright FL 1000 (Product # A32752). Chemiluminescent detection was performed using Novex® ECL Chemiluminescent Substrate Reagent Kit (Product # WP20005).

RAGE Antibody in Western Blot (WB) — Western blot analysis of RAGE in Lane 1: rat lung tissue lysate, Lane 2: RH35 whole cell lysate, Lane 3: HeLa whole cell lysate using 40-50 µg per well. Sample was incubated with RAGE (Product # PA5-78736) at a dilution of 0.5 µg/mL.

RAGE Antibody — Antibody specificity was demonstrated by detection of differential basal expression of the target across tissues owing to their inherent genetic constitution. The expression was observed in Mouse Lung, Rat Lung and less in Mouse Brain and Mouse cerebellum using RAGE Polyclonal Antibody (Product # PA5-78736) in western blot. {RE}

Product Details

PA5-78736

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-
Immunohistochemistry (Paraffin) (IHC (P))	0.5-1 µg/mL	-

Product Specifications
Species Reactivity	Human, Mouse, Rat
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI). View immunogen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 5mg BSA
Contains	0.05mg sodium azide
Storage conditions	-20°C
RRID	AB_2745852

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: advanced glycation end-products receptor; Advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE-4 ORF3; receptor for advanced glycation end-products variant 20; Receptor for advanced glycosylation end products; sRAGE

Gene Aliases: AGER; RAGE; SCARJ1

UniProt ID: (Human) Q15109, (Mouse) Q62151

Entrez Gene ID: (Human) 177, (Rat) 81722, (Mouse) 11596

Molecular Function: cell adhesion molecule immunoglobulin superfamily cell adhesion molecule

regulation of T cell mediated cytotoxicity negative regulation of protein phosphorylation positive regulation of protein phosphorylation negative regulation of endothelial cell proliferation inflammatory response negative regulation of cell adhesion cell surface receptor signaling pathway JAK-STAT cascade brain development glycoprotein metabolic process response to wounding response to fructose positive regulation of autophagy negative regulation of endothelial cell migration positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of fibroblast migration response to activity positive regulation of smooth muscle cell migration lung development neuron projection development negative regulation of interleukin-10 production positive regulation of interleukin-12 production negative regulation of collagen biosynthetic process response to vitamin A response to genistein negative regulation of osteoblast proliferation cellular response to drug positive regulation of activated T cell proliferation positive regulation of neuron apoptotic process innate immune response positive regulation of fibroblast proliferation positive regulation of smooth muscle cell proliferation positive regulation of inflammatory response positive regulation of NF-kappaB transcription factor activity response to methylglyoxal calcium ion homeostasis response to hyperoxia positive regulation of phagocytosis, engulfment transdifferentiation cellular response to hydrogen peroxide cellular response to glucose stimulus cellular response to fatty acid cellular response to organic cyclic compound response to selenite ion positive regulation of potassium ion transmembrane transporter activity positive regulation of endothelial cell apoptotic process positive regulation of reactive oxygen species metabolic process regulation of CD4-positive, alpha-beta T cell activation positive regulation of type B pancreatic cell apoptotic process positive regulation of dendritic cell differentiation response to hypoxia positive regulation of cell migration positive regulation of apoptotic process positive regulation of JUN kinase activity regulation of inflammatory response induction of positive chemotaxis regulation of DNA binding protein localization to membrane positive regulation of neuron death

Process(es)

receptor activity transmembrane signaling receptor activity protein binding identical protein binding S100 protein binding advanced glycation end-product receptor activity high mobility group box 1 binding