Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Invitrogen
This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2745852 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: advanced glycation end-products receptor; Advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE-4 ORF3; receptor for advanced glycation end-products variant 20; Receptor for advanced glycosylation end products; sRAGE
Gene Aliases: AGER; RAGE; SCARJ1
UniProt ID: (Human) Q15109, (Mouse) Q62151
Entrez Gene ID: (Human) 177, (Rat) 81722, (Mouse) 11596
Molecular Function:
cell adhesion molecule
immunoglobulin superfamily cell adhesion molecule
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support