Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture and Transfection
    • Chemicals
    • Chromatography
    • Electron Microscopes
    • Lab Plasticware and Supplies
    • Lab Centrifuges
    • Lab Solutions
    • Mass Spectrometers
    • Next Generation Sequencers
    • See all product categories
  • Applications
    • Brands
    • Industrial and Applied Sciences
    • Food and Beverage
    • Forensics
    • Lab Solutions
    • Life Sciences
    • Pharma and Biopharma
    • Biotechnology
    • Clinical and Diagnostics
    • Digital Solutions
    • See all applications
  • Services
    • Lab Instrument and Equipment Services
    • Custom Services
    • Training Services
    • Financial and Leasing Services
    • Enterprise Level Lab Informatics
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Cell Biology Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • Contact Us
    • Product Documentation
    • Knowledge Base and Product FAQs
    • Learning Centers
    • Supply Center
    • eProcurement Solutions
    • Lab Instrument and Equipment Support
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • RbAp48 Antibodies

          Invitrogen

          RbAp48 Monoclonal Antibody (9F3)

          View all (22) RbAp48 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite RbAp48 Monoclonal Antibody (9F3)

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (11)
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 11

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RbAp48 Antibody (MA5-33003) in IHC (P)

          Immunohistochemical analysis of RbAp48 in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL mouse anti-RbAp48 antibody (Product # MA5-33003) overnight at 4°C. Biotinylated goat anti-mou... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Western Blot (WB)
          RbAp48 Antibody in Western Blot (WB)
          RbAp48 Antibody in Flow Cytometry (Flow)
          RbAp48 Antibody in Flow Cytometry (Flow)
          RbAp48 Monoclonal Antibody (9F3)

          Product Details

          MA5-33003

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Mouse / IgG1

          Class

          Monoclonal

          Type

          Antibody

          Clone

          9F3

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2802637

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Jurkat whole cell, rat thymus tissue, mouse spleen tissue, human A549 whole cell, human Jurkat whole cell, human Hela whole cell, human PANC-1 whole cell. IHC: human intestinal cancer tissue, human placenta tissue, human mammary cancer tissue, human intestinal cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue. Flow: SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; Chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; Histone-binding protein RBBP4; MSI1 protein homolog; Nucleosome-remodeling factor subunit RBAP48; RBBP-4; Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; unnamed protein product

          View more View less

          Gene Aliases: lin-53; mRbAp48; NURF55; RBAP48; RBBP4

          View more View less

          UniProt ID: (Human) Q09028, (Mouse) Q60972

          View more View less

          Entrez Gene ID: (Human) 5928, (Rat) 313048, (Mouse) 19646

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding protein binding DNA-dependent ATPase activity nucleosomal DNA binding histone binding histone deacetylase binding RNA polymerase II distal enhancer sequence-specific DNA binding molecular_function
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter DNA replication DNA repair chromatin organization nucleosome assembly DNA replication-dependent nucleosome assembly chromatin remodeling regulation of transcription, DNA-templated cellular response to DNA damage stimulus brain development negative regulation of cell proliferation negative regulation of cell migration negative regulation of transforming growth factor beta receptor signaling pathway regulation of cell fate specification negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated negative regulation of stem cell population maintenance positive regulation of stem cell population maintenance regulation of stem cell differentiation DNA replication-independent nucleosome assembly metabolic process chromatin assembly ATP-dependent chromatin remodeling response to growth hormone transcription, DNA-templated cell cycle chromatin modification
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Quick Order
          • eProcurement
          • Supply Center
          • Order Status
          • Chemicals
          • India Mobile App
          • Government eMarketplace
          Support Plus Icon Minus Icon
          • Order Support
          • Training
          • Contact Us
          • Report a Site Issue
          • Instrument Management
          Resources Plus Icon Minus Icon
          • Product Selection Guides
          • Mobile & Desktop Apps
          • Webinars
          • Blog 
          • Social Media
          • New Products
          • Promotions
          • Shared Lists
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          India flag icon
          India

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-nrcn4:80/100.66.78.247:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline