Search
Invitrogen
TCP1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 7
TCP1 Antibody (PA5-80100) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of TCP1 in CACO-2 cells using TCP1 Polyclonal Antibody (Product # PA5-80100). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. DyLight 488 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter set... View More
Product Details
PA5-80100
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human A431 whole cell lysates, human Hela whole cell lysates, human 293T whole cell lysates, human MOLT4 whole cell lysates, human Jurkat whole cell lysates, human A549 whole cell lysates, human MCF-7 whole cell lysates, human U251 whole cell lysates, rat heart tissue lysates, rat ovary tissue lysates, rat brain tissue lysates, rat lung tissue lysates, mouse heart tissue lysates, mouse ovary tissue lysates, mouse brain tissue lysates, mouse lung tissue lysates. IHC: mouse testis tissue, rat testis tissue, human testis tissue, human ovary cancer tissue. ICC/IF: CACO-2 cell.
Target Information
The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CCT-alpha; Chaperonin containing T-complex polypeptide 1 subunit 1; t-complex polypeptide 1; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha A; T-complex protein 1 subunit alpha B; T-complex protein 1, alpha subunit; tailless complex polypeptide 1; Tailless complex polypeptide 1A; Tailless complex polypeptide 1B; TCP-1-A; TCP-1-alpha; TCP-1-B
Gene Aliases: AI528772; c-cpn; CCT; CCT-alpha; CCT1; CCTA; CCTalpha; D6S230E; p63; Tcp-1; TCP-1-alpha; TCP1; Tp63; TRic
UniProt ID: (Human) P17987, (Rat) P28480, (Mouse) P11983
Entrez Gene ID: (Human) 6950, (Rat) 24818, (Mouse) 21454
protein folding
tubulin complex assembly
binding of sperm to zona pellucida
positive regulation of telomere maintenance via telomerase
translocation of peptides or proteins into host cell cytoplasm
protein stabilization
positive regulation of telomerase activity
scaRNA localization to Cajal body
toxin transport
positive regulation of establishment of protein localization to telomere
positive regulation of protein localization to Cajal body
positive regulation of telomerase RNA localization to Cajal body
regulation of macrophage apoptotic process
spermatid development
cellular protein metabolic process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support