Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ZP3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
ZP3 Antibody (PA5-95637) in WB
Western blot analysis of ZP3 using ZP3 Polyclonal Antibody (Product # PA5-95637). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human MCF-7 whole cell lysates. Lane 2: human A549 whole cell lysates. Lane 3: human Hela whole cell lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat mi... View More
Product Details
PA5-95637
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human MCF-7 whole cell, human A549 whole cell, human Hela whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Sperm receptor; Zona pellucida glycoprotein 3; zona pellucida glycoprotein 3A (sperm receptor); zona pellucida glycoprotein 3B; zona pellucida glycoprotein ZP3; Zona pellucida protein C; Zona pellucida sperm-binding protein 3; Zp-3; ZP3A/ZP3B
Gene Aliases: Zp-3; ZP3; ZP3A; ZP3B; ZPC
UniProt ID: (Human) P21754
Entrez Gene ID: (Human) 7784
positive regulation of type IV hypersensitivity
blastocyst formation
humoral immune response mediated by circulating immunoglobulin
positive regulation of leukocyte migration
positive regulation of humoral immune response
manganese ion transport
intracellular protein transport
binding of sperm to zona pellucida
positive regulation of phosphatidylinositol biosynthetic process
positive regulation of interferon-gamma production
positive regulation of interleukin-4 production
intracellular signal transduction
egg coat formation
positive regulation of T cell proliferation
positive regulation of protein kinase activity
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
phosphatidylinositol-mediated signaling
oocyte development
positive regulation of inflammatory response
positive regulation of protein kinase B signaling
protein kinase C signaling
calcium ion transmembrane transport
manganese ion transmembrane transport
positive regulation of calcium ion import
positive regulation of acrosome reaction
negative regulation of binding of sperm to zona pellucida
positive regulation of acrosomal vesicle exocytosis
positive regulation of ovarian follicle development
positive regulation of antral ovarian follicle growth
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support