Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • KV1.2 (KCNA2) Antibodies

          Invitrogen

          KV1.2 (KCNA2) Polyclonal Antibody

          View all (21) KV1.2 (KCNA2) antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite KV1.2 (KCNA2) Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          KV1.2 (KCNA2) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          KV1.2 (KCNA2) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          KV1.2 (KCNA2) Antibody (PA5-144086) in ICC/IF

          Immunocytochemistry analysis of KV1.2 (KCNA2) in U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in KV1.2 (KCNA2) Polyclonal antibody (Product # PA5-144086) using a dilution of 2 μg/mL. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          KV1.2 (KCNA2) Antibody in Immunocytochemistry (ICC/IF)
          KV1.2 (KCNA2) Antibody in Western Blot (WB)
          KV1.2 (KCNA2) Antibody in Flow Cytometry (Flow)
          KV1.2 (KCNA2) Antibody in Flow Cytometry (Flow)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          KV1.2 (KCNA2) Polyclonal Antibody

          Product Details

          PA5-144086

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_3075300

          Product Specific Information

          Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

          Immunogen sequence is identical to the related mouse and rat sequences.

          Positive Control - WB: Rat Kidney Tissue, Rat Brain Tissue, Mouse Brain Tissue, Mouse Kidney Tissue. ICC/IF: U20S cell. Flow: A431 cell, C6 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Kcna2 is a voltage-gated potassium channel (KV) that belongs to the 6-TM family of potassium channel and also comprises the Ca2+-activated Slo (actually 7-TM) and the Ca2+-activated SK subfamilies. The alpha-subunits contain a single pore-forming region and combine to form tetramers. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. The diverse functions of potassium channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). The Kcna2 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. Kcna2 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. Further, Kcna2 belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of the Kcna2 gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: MK2; Potassium (K+) channel protein alpha 2, voltage dependent; potassium channel (BK2) (put.); putative; potassium channel, voltage gated shaker related subfamily A, member 2; Potassium voltage gated channel shaker related subfamily member 2; potassium voltage-gated channel, shaker-related subfamily, member 2; RAK; RBK2; RCK5; RP11-284N8.1; unnamed protein product; voltage-gated K(+) channel HuKIV; voltage-gated potassium channel HBK5; voltage-gated potassium channel protein Kv1.2; voltage-gated potassium channel subunit Kv1.2

          View more View less

          Gene Aliases: Akr6a4; BK2; DEE32; EIEE32; Gm10672; HBK5; HK4; HUKIV; Kca1-2; KV1.2; Mk-2; MK2; NGK1; RBK2

          View more View less

          UniProt ID: (Human) P16389, (Mouse) P63141, (Rat) P63142

          View more View less

          Entrez Gene ID: (Human) 3737, (Mouse) 16490, (Rat) 25468

          View more View less

          Function(s)
          ion channel activity voltage-gated potassium channel activity delayed rectifier potassium channel activity potassium channel activity protein binding outward rectifier potassium channel activity kinesin binding voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential voltage-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
          Process(es)
          action potential ion transport potassium ion transport regulation of dopamine secretion neuronal action potential sensory perception of pain optic nerve development optic nerve structural organization cerebral cortex development corpus callosum development regulation of circadian sleep/wake cycle, non-REM sleep protein homooligomerization transmembrane transport regulation of postsynaptic membrane potential potassium ion transmembrane transport potassium ion export across plasma membrane regulation of presynaptic membrane potential
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-5799cd5976-pj9bv:80/100.66.77.38:80.
          git-commit: e30ab741173a2eb62411af663260592d4bdb9634
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.55.0-2026.07.30-1.0