Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • SERCA3 ATPase Antibodies

          Invitrogen

          SERCA3 ATPase Polyclonal Antibody

          View all (9) SERCA3 ATPase antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite SERCA3 ATPase Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          SERCA3 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SERCA3 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SERCA3 ATPase Antibody (PA5-78838) in IHC (P)

          Immunohistochemistry analysis of SERCA3 ATPase on paraffin-embedded mouse Thymus tissue. Sample was incubated with SERCA3 ATPase polyclonal antibody (Product# PA5-78838). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SERCA3 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SERCA3 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SERCA3 ATPase Antibody in Western Blot (WB)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          SERCA3 ATPase Polyclonal Antibody

          Product Details

          PA5-78838

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3 (1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745954

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Skeletal Muscle Tissue, Mouse Skeletal Muscle Tissue. IHC: Mouse Thymus Tissue, Rat Thymus Tissue.

          Target Information

          ATP dependent calcium pumps are responsible in part for the maintenance of low cytoplasmic free calcium concentrations. The ATP pumps that reside in intracellular organelles are encoded by a family of structurally related enzymes, termed the sarcoplasmic or endoplasmic reticulum calcium ATPases (SERCA). The SERCA2 gene is subject to tissue dependent processing which is responsible for the generation of SERCA2a muscle-specific isoform expressed in type I (slow) skeletal, cardiac and smooth muscle and the SERCA2b isoform expressed in all cell types. SERCA3 has been found to co-express with SERCA2b in platelets, mast cells, lymphoid cells, and epithelial cells. Due to this pattern of expression it is referred to as the non-muscle form of SERCA.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adenosine triphosphatase, calcium; ATPase, Ca(2+)-transporting, ubiquitous; ATPase, Ca++ transporting, ubiquitous; Ca-2+ pump; calcium ATPase; SERCA3f; calcium pump 3; calcium-translocating P-type ATPase; sarco /endoplasmic reticulum Ca2+ -ATPase; sarco/endoplasmic reticulum Ca(2+)-ATPase 3-type Ca2+ pump; sarco/endoplasmic reticulum Ca2+ -ATPase; sarcoendoplasmic reticulum Ca2+ ATPase type 3; SERCA3; Serca3b/c; SERCA3D; SERCA3E; SR Ca(2+)-ATPase 3; unnamed protein product

          View more View less

          Gene Aliases: SERCA3; SERCA3b

          View more View less

          UniProt ID: (Human) Q93084, (Mouse) Q64518, (Rat) P18596

          View more View less

          Entrez Gene ID: (Human) 489, (Mouse) 53313, (Rat) 25391

          View more View less

          Function(s)
          nucleotide binding calcium channel regulator activity calcium-transporting ATPase activity protein binding ATP binding cysteine-type endopeptidase activator activity involved in apoptotic process calcium ion transmembrane transporter activity ATPase activity calcium-dependent ATPase activity ion channel binding calcium ion binding
          Process(es)
          calcium ion transport cellular calcium ion homeostasis endoplasmic reticulum calcium ion homeostasis intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress calcium ion transmembrane transport calcium ion transport from cytosol to endoplasmic reticulum ion transmembrane transport transport across blood-brain barrier regulation of cardiac conduction liver regeneration
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-76c4fffd86-cbn8l:80/100.66.77.38:80.
          git-commit: bdc067a1e9e92d056899a2dda64af631988aa8a1
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.54.0-Offline