Search
Invitrogen
Haptoglobin Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
Haptoglobin Antibody (PA5-79391) in WB
Liver international : official journal of the International Association for the Study of the Liver 2021 -
2 FIGURE Immunohistochemistry for immunodetection of Hp in liver biopsy tissue and Western Blot. 2.1 Immunohistochemistry for immunodetection of Hp in liver biopsy tissue. A, Control tissue stained with the monoclonal anti-haptoglobin antibody. Positive staining reaction shows (brown) presence of haptoglobin in the cytoplasm of hepatocytes. Original magnification 400x. B, The monoclonal antibody is not able... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79391
Applications
Tested Dilution
Publications
Product Specifications
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin.
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
Product Specific Information
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin (128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Target Information
Haptoglobin is an a2-globulin plasma protein synthesized in the liver. It is an acute phase protein which also acts as a scavenger of hemoglobin from hemolyzed red cells. The haptoglobin monomer consists of two a and two beta chains; the a chains bay be hp1Fa, hp1Sa, or hp2a types while the beta chain is constant. Three major phenotypes are recognized: HP1-1, Hp2-1 and Hp-2-2, in which the hp1a chain bay be either the F or S type.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support