Search
Invitrogen
CD171 (L1CAM) Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 7
CD171 (L1CAM) Antibody (PA5-79573) in IHC (P)
Immunohistochemistry analysis of CD171 (L1CAM) on paraffin-embedded human mammary cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with CD171 (L1CAM) polyclonal antibody (Product# PA5-79573) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 m... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79573
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - IHC: mouse brain tissue, mouse brain tissue, rat brain tissue, human colon cancer tissue, human glioma tissue, human lung cancer tissue, human mammary cancer tissue.
Target Information
L1CAM/CD171 is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: antigen identified by monoclonal antibody R1; CD 171; CD171 molecule; IgG super gene family; N-CAM-L1; NCAM-L1; nerve-growth factor-inducible large external glycoprotein; neuron-glia cell adhesion molecule; NILE; sCD171; sL1 CAM; sL1CAM; soluble CD 171; soluble CD171; soluble L1 CAM; soluble L1CAM; unnamed protein product
Gene Aliases: CAML1; CD171; HSAS; HSAS1; HYCX; Hyd; L1; MASA; MIC5; N-CAM L1; N-CAM-L1; N-CAML1; NCAM-L1; NCAML1; NgCAM; S10; SPG1
UniProt ID: (Human) P32004, (Rat) Q05695
Entrez Gene ID: (Human) 3897, (Rat) 50687, (Mouse) 16728
regulation of protein phosphorylation
homophilic cell adhesion via plasma membrane adhesion molecules
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
leukocyte cell-cell adhesion
cell-matrix adhesion
cell surface receptor signaling pathway
axon guidance
axonal fasciculation
positive regulation of cell-substrate adhesion
regulation of neuron projection development
response to activity
cell migration
positive regulation of cell-cell adhesion
neuron differentiation
neuron projection development
cell-cell adhesion mediated by integrin
homotypic cell-cell adhesion
protein localization to plasma membrane raft
positive regulation of axon extension
positive regulation of cell adhesion
modulation of synaptic transmission
synapse organization
positive regulation of calcium-mediated signaling
regulation of synapse assembly
axon development
regulation of ERK1 and ERK2 cascade
cellular response to ethanol
dopaminergic neuron differentiation
cellular response to dexamethasone stimulus
cellular response to transforming growth factor beta stimulus
response to thyroid hormone
cellular response to thyroxine stimulus
cerebellar neuron development
maintenance of synapse structure
response to toluene
cellular response to nerve growth factor stimulus
chemotaxis
cell adhesion
nervous system development
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support