Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • MUC2 Antibodies

          Invitrogen

          MUC2 Polyclonal Antibody

          2 Published Figures
          11 References
          View all (46) MUC2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite MUC2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (13)
          • Published Figures (2)
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 15

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MUC2 Antibody (PA5-79702) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of MUC2 in paraffin-embedded section of human colon organoid tissue using MUC2 Polyclonal Antibody (Product # PA5-79702). Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL diluti... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MUC2 Antibody in Immunohistochemistry (IHC)
          MUC2 Antibody in Immunohistochemistry (PFA fixed) (IHC (PFA))

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          MUC2 Polyclonal Antibody

          Product Details

          PA5-79702

          Applications
          Tested Dilution
          Publications

          Immunohistochemistry (IHC)

          -
          View 7 publications 7 publications

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (PFA fixed) (IHC (PFA))

          -
          View 2 publications 2 publications

          Immunocytochemistry (ICC/IF)

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Horse, Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746817

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - IHC: human colon cancer tissue, mouse colon tissue, rat colon tissue.

          Target Information

          Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity. Mucin 2 is the major intestinal mucin. O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogeneous and exogeneous lectins.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: colonic mucin; intestinal mucin; intestinal mucin-2; MUC-2; MUC2; mucin 2, intestinal/tracheal; mucin-like protein; secreted gel-forming mucin; unnamed protein product

          View more View less

          Gene Aliases: 2010015E03Rik; AABR07006030.1; HH-Muc; MCM; MLP; MUC-2; SMUC; wnn

          View more View less

          UniProt ID: (Human) Q02817

          View more View less

          Entrez Gene ID: (Human) 4583, (Rat) 24572, (Mouse) 17831

          View more View less

          Function(s)
          extracellular matrix structural constituent protein binding cupric ion binding cuprous ion binding identical protein binding
          Process(es)
          epithelial cell development apoptotic process negative regulation of cell proliferation response to hormone detoxification of copper ion maintenance of gastrointestinal epithelium negative regulation of cell migration response to lipopolysaccharide response to vitamin A positive regulation of apoptotic process host-mediated regulation of intestinal microbiota composition mucus secretion cellular response to interleukin-1 cellular response to tumor necrosis factor response to transforming growth factor beta response to Gram-positive bacterium
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-5799cd5976-swbc5:80/100.66.77.38:80.
          git-commit: e30ab741173a2eb62411af663260592d4bdb9634
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.55.0-2026.07.30-1.0