Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • NME1 Antibodies

          Invitrogen

          NME1 Polyclonal Antibody

          View all (118) NME1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite NME1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          NME1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          NME1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          NME1 Antibody (PA5-79743) in WB

          Western blot analysis of NME1 using NME1 Polyclonal Antibody (Product # PA5-79743). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: rat brain tissue lysates. Lane 2: rat liver tissue lysates. Lane 3: rat lung tissue lysates. Lane 4: rat C6 whole cell lysates. Lane 5: mouse brain tissue lysates. Lane 6: mouse liver tissue lysates. Lane 7: mouse lung tissue lysates. Lane 8: mouse NIH/3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          NME1 Antibody in Western Blot (WB)
          NME1 Antibody in Western Blot (WB)
          NME1 Antibody in Flow Cytometry (Flow)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          NME1 Polyclonal Antibody

          Product Details

          PA5-79743

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746858

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human A431 whole cell, human HepG2 whole cell, human K562 whole cell, human MCF-7 whole cell, human A375 whole cell, human MOLT-4 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat C6 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse NIH/3T3 whole cell. Flow: HEL cell.

          Target Information

          NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: epididymis secretory sperm binding protein; expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); farnesyl diphosphate kinase NME1; Granzyme A activated DNase (GAAD); granzyme A-activated DNase; GZMA activated DNase; histidine protein kinase NDK; histidine protein kinase NME1; included; metastasis inhibition factor NM23; NDK A; NDP kinase A; NDP kinase beta; NM23H1; NM23H1B; NME1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; non-specific serine/threonine protein kinase NME1; nucleoside diphoshate kinase 1; nucleoside-diphosphate kinase 1; nucleotide diphosphate kinase; nucloside diphosphate kinase; putative 3'-5'-DNA exonuclease NDK1; putative granzyme A-activated DNA endonuclease; tumor metastatic process-associated protein; tumor metastatic process-associated protein NM23; unnamed protein product

          View more View less

          Gene Aliases: AWD; GAAD; NB; NBS; NDK1; NDKA; NDPK A; NDPK-A; NDPKA; NM23; NM23-H1; NM23-M1; NM23A

          View more View less

          UniProt ID: (Human) P15531, (Mouse) P15532, (Rat) Q05982

          View more View less

          Entrez Gene ID: (Human) 4830, (Mouse) 18102, (Rat) 191575

          View more View less

          Function(s)
          magnesium ion binding DNA binding RNA binding endodeoxyribonuclease activity deoxyribonuclease activity nucleoside diphosphate kinase activity protein histidine kinase activity protein serine/threonine kinase activity protein binding 3'-5'-exodeoxyribonuclease activity kinase activity phosphotransferase activity, phosphate group as acceptor GDP binding identical protein binding ribosomal small subunit binding ADP binding farnesyl diphosphate kinase activity protein serine kinase activity coenzyme A binding succinyl-CoA binding acetyl-CoA binding RNA polymerase II regulatory region sequence-specific DNA binding single-stranded DNA binding intermediate filament binding enzyme binding protein kinase binding gamma-tubulin binding
          Process(es)
          negative regulation of myeloid leukocyte differentiation GTP biosynthetic process UTP biosynthetic process dTMP biosynthetic process CTP biosynthetic process DNA catabolic process apoptotic DNA fragmentation isoprenoid metabolic process nucleoside phosphate metabolic process lactation nucleoside diphosphate metabolic process nucleoside triphosphate biosynthetic process negative regulation of gene expression positive regulation of neuron projection development mammary gland development protein hexamerization regulation of fatty acid biosynthetic process ITP biosynthetic process acetyl-CoA catabolic process positive regulation of epithelial cell proliferation purine-containing compound metabolic process response to xenobiotic stimulus response to amine hippocampus development response to testosterone response to cAMP cellular response to glucose stimulus cellular response to fatty acid cellular response to xenobiotic stimulus base-excision repair negative regulation of cell proliferation granzyme-mediated apoptotic signaling pathway regulation of apoptotic process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-76c4fffd86-nv6df:80/100.66.78.131:80.
          git-commit: bdc067a1e9e92d056899a2dda64af631988aa8a1
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.54.0-Offline