Search
Invitrogen
SMURF2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:
FIGURE: 1 / 2
SMURF2 Antibody (PA5-80044) in WB
Western blot analysis of SMURF2 in, Lane 1: rat testis tissue lysates, Lane 2: rat pancreas tissue lysates, Lane 3: rat stomach testis lysates, Lane 4: mouse testis tissue lysates. Lane 5: mouse pancreas tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was b... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-80044
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL once reconstituted
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: SMMC whole cell, rat testis tissue, rat pancreas tissue, rat stomach testis, mouse testis tissuemouse pancreas tissue.
Target Information
SMURF2 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. This protein interacts with SMAD1, SMAD2 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. It enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: E3 ubiquitin ligase SMURF2; HECT-type E3 ubiquitin transferase SMURF2; hSMURF2; SMAD ubiquitination regulatory factor 2; unnamed protein product
Gene Aliases: 2810411E22Rik; RGD1310067
UniProt ID: (Human) Q9HAU4, (Mouse) A2A5Z6
Entrez Gene ID: (Human) 64750, (Rat) 303614, (Mouse) 66313
ubiquitin-dependent protein catabolic process
protein ubiquitination
negative regulation of transforming growth factor beta receptor signaling pathway
negative regulation of BMP signaling pathway
negative regulation of MyD88-dependent toll-like receptor signaling pathway
proteasome-mediated ubiquitin-dependent protein catabolic process
positive regulation of smoothened signaling pathway
positive regulation of ferroptosis
positive regulation of trophoblast cell migration
lysosomal protein catabolic process
negative regulation of transcription from RNA polymerase II promoter
regulation of transforming growth factor beta receptor signaling pathway
negative regulation of transcription, DNA-templated
Wnt signaling pathway, planar cell polarity pathway
positive regulation of canonical Wnt signaling pathway
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support