Search
Invitrogen
beta-5 Tubulin Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 8
beta-5 Tubulin Antibody (PA5-80198) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of Beta III Tubulin in U2OS cells using Beta III Tubulin Polyclonal Antibody (Product # PA5-80198). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. Cy3 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:... View More
Product Details
PA5-80198
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Chicken,
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human testicular germ cell tumor tissue. ICC/IF: U20S cell. Flow: SiHa cell.
Target Information
Microtubules, the major cytoskeletal elements found in all eukaryotic cells, consist of Tublin, which is a dimer of two 55kDa subunits: alpha and Beta. Microtubules play key roles in chromosome segregation in mitosis, intracellular transport, ciliary and flagellar bending, and structural support of the cytoskeleton. This antibody does not cause the 10-nm filaments to collapse into large lateral aggregates collecting in the cell periphery or tight juxtanuclear caps. It does not block microtubule assembly. Ab-3 does not inhibit polymerization or depolymerization of platelet tubulin in vitro. It blocks (by 70-80%) the ability of tubulin dimers (with GppNHp bound) to promote a stable inhibition of adenylyl cyclase.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: beta 5-tubulin; beta Ib tubulin; c(beta)7 tubulin; epididymis secretory sperm binding protein; tbb5; tubulin beta; Tubulin beta 4'; Tubulin beta chain; tubulin beta-1 chain; Tubulin beta-5 chain; Tubulin beta-7 chain; tubulin, beta 2A; tubulin, beta polypeptide; unnamed protein product; XTP3TPATP1
Gene Aliases: AA408537; AI596182; B130022C14Rik; CDCBM6; CSCSC1; M(beta)5; M40; OK/SW-cl.56; TUBB; TUBB1; TUBB5
UniProt ID: (Human) P07437, (Chicken) P09244, (Mouse) P99024, (Rat) P69897
Entrez Gene ID: (Human) 203068, (Chicken) 396254, (Mouse) 22154, (Rat) 29214
nucleotide binding
GTPase activity
structural molecule activity
structural constituent of cytoskeleton
protein binding
GTP binding
protein domain specific binding
ubiquitin protein ligase binding
GTPase activating protein binding
MHC class I protein binding
macromolecular complex binding
metal ion binding
protein complex binding
tubulin
microtubule cytoskeleton organization
mitotic cell cycle
microtubule-based process
cytoskeleton-dependent intracellular transport
natural killer cell mediated cytotoxicity
regulation of synapse organization
spindle assembly
cell division
odontoblast differentiation
cellular process
protein polymerization
biological_process
metabolic process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support