Search
Invitrogen
VRK1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
VRK1 Antibody (PA5-80222) in WB
Western blot analysis of VRK1 in rat thymus extract (lane 1) and JURKAT whole cell lysate (lane 2). Sample was incubated with VRK1 polyclonal antibody (Product # PA5-80222) at a dilution of 0.5 µg/mL. Signal development was performed using a chemiluminescence (ECL) kit.
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-80222
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat thymus tissue, JURKAT whole cell.
Target Information
Human vaccinia-related kinase 1 (VRK1) is a new kinase related to a poxvirus kinase, and more distantly to the casein kinase 1 family. VRK1 shows strong autophosphorylating activity in several Ser and Thr residues. VRK has also been found to be an upstream regulator of p53 that belongs to a new signaling pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MGC117401; MGC138280; unnamed protein product; vaccinia related kinase 1; vaccinia virus B1R-related kinase 1
Gene Aliases: HMNR10; PCH1; PCH1A
UniProt ID: (Human) Q99986
Entrez Gene ID: (Human) 7443, (Rat) 362779
protein kinase activity
protein serine/threonine kinase activity
protein binding
ATP binding
kinase activity
protein kinase binding
nucleosomal DNA binding
histone kinase activity (H3-S10 specific)
histone binding
histone kinase activity (H3-T3 specific)
protein serine kinase activity
histone H2AX kinase activity
nucleotide binding
chromatin remodeling
protein phosphorylation
cellular response to DNA damage stimulus
mitotic nuclear envelope disassembly
signal transduction
Cajal body organization
neuron projection development
protein autophosphorylation
Golgi disassembly
positive regulation of protein localization to chromatin
regulation of neuron migration
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support