Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PPP1R10 (aa 201-295) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-103005
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDAL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
RNA polymerases transcribe nuclear genes for ribosomal RNA, thus representing ribosomal biogenesis. RNA polymerase I (Pol I) is located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription machinery are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I transcription. RPA40 and RPA16 are subunits of Pol I that associate with each other at an early stage of RNA polymerase I assembly. RPA40 is essential for the function and integrity of the complex and is also an essential subunit of RNA polymerase III (Pol III). RPA40, RPA16 and RPA135 encode the three subunits of RNA polymerase I, respectively. RPA194 is the largest subunit of RNA Pol I and is not a component of Pol II and Pol III.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: HLA-C associated transcript 53; MHC class I region proline-rich protein CAT53; p99; Phosphatase 1 nuclear targeting subunit; PNUTSPP1R10; PP1-binding protein of 114 kDa; Protein FB19; protein phosphatase 1, regulatory (inhibitor) subunit 10; protein phosphatase 1, regulatory subunit 10; Serine/threonine-protein phosphatase 1 regulatory subunit 10; testis tissue sperm-binding protein Li 67n
Gene Aliases: CAT53; FB19; p99; PNUTS; PP1R10; PPP1R10; R111
UniProt ID: (Human) Q96QC0
Entrez Gene ID: (Human) 5514
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support