Search
Invitrogen
Human Apolipoprotein B (aa 591-689) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-103054
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111298. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Apolipoprotein B (apo B) in human plasma is a major protein of low density lipoproteins (LDL) with a molecular mass of approximately 260-500 kDa. Apolipoprotein B binds to specific receptors on cell membranes and is involved in removal of LDL and very low density lipoprotein (VLDL) cholesterol from circulation. Low-density lipoprotein (LDL) is the carrier protein for cholesterol in the blood. LDL binds to its receptor on the capillary walls and thereby mediates the uptake and clearance of cholesterol from the circulation. In atherosclerotic lesions oxidatively modified LDL is found and oxidized LDL is specifically recognized and ingested by macrophages via scavenger receptor A and CD36. Oxidized LDL may be a marker of atherosclerosis but the precise changes in oxidized LDL are not well described. MDA-oxidized LDL appear to be different from LDL oxidized by other means. Apolipoprotein B is mostly synthesized in the liver, and is a major apolipoprotein of very low density, intermediate density and low density lipoproteins (LDL) as well as being a major component of lipoprotein (a). Apolipoprotein B is a ligand for the LDL receptor and elevated levels are associated with premature atherosclerosis. Normal plasma apolipoprotein B levels are around 800mg/L. Apolipoprotein B occurs in plasma as two main isoforms, apoB-48 and apoB-100. The intestinal and the hepatic forms of Apolipoprotein B are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in the Apolipoprotein B gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective Apolipoprotein B, diseases affecting plasma cholesterol and Apolipoprotein B levels.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Apo B-100; Apo B100; apo-B; ApoB 100; ApoB 48; apolipo b; apolipoprotein B; apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; apolipoprotein B precursor; Apolipoprotein B-100; apolipoprotein B-100 precursor; apolipoprotein B-48; Apolipoprotein B100; apolipoprotein B100 precursor; apolipoprotein B46; apolipoprotein B47; apolipoprotein B48; apolipoprotein B49; LOX-1; mCG_129875; MGC176318; Ox-LDL receptor 1; truncated apolipoprotein B-48; unnamed protein product
Gene Aliases: APOB; apoB-100; apoB-48; FCHL2; FLDB; LDLCQ4
UniProt ID: (Human) P04114
Entrez Gene ID: (Human) 338
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support