Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FceR1 alpha (aa 59-190) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-105915
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Fc epsilon RI alpha, also known as FceR1 alpha, is a subunit of the high-affinity receptor for IgE, primarily expressed on mast cells and basophils. Its expression is upregulated by the presence of IgE. Fc epsilon RI alpha forms a tetrameric complex with one beta and two gamma subunits, which are essential for signal transduction. The beta and gamma subunits contain immunoreceptor tyrosine-based activation motifs (ITAMs). The Fc epsilon RI complex plays a crucial role in triggering IgE-mediated allergic reactions. When allergen-bound IgE molecules bring together two or more high-affinity IgE receptors, it leads to the release of mediators such as histamine, which are responsible for allergy symptoms. This process couples allergens and mast cells to initiate inflammatory responses characteristic of allergic disorders like hay fever and asthma. The release of histamine and proteases also leads to the synthesis of prostaglandins and leukotrienes, which are potent effectors of the hypersensitivity response.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: fc epsilon r1; Fc epsilon receptor Ia; Fc epsilon RI alpha-chain; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; Fc IgE receptor, alpha polypeptide; Fc-epsilon RI-alpha; FcERI; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor subunit alpha; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; RP11-550P17.3
Gene Aliases: FCE1A; FCER1A; FcERI
UniProt ID: (Human) P12319
Entrez Gene ID: (Human) 2205
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support