Search
Invitrogen
Human CHD9 (aa 176-291) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-109100
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CHD9 (chromodomain-helicase-DNA-binding protein 9), also known as chromatin-related mesenchymal modulator (CReMM), PPAR-α-interacting complex protein, kismet homolog 2 or CHROM1, is a 2,897 amino acid protein belonging to the Snf2/Rad54 helicase family. The CHD family of proteins are ATP-dependent chromatin remodeling enzymes which combine chromodomains with SWI2/Snf2 ATPase/helicase motifs and DNA-binding capability. Localized to the cytoplasm and the nucleus, CHD9 contains two chromodomains, one ATPbinding helicase domain and one C-terminal helicase domain. Chromodomains are protein regions of about 40-50 amino acid residues found in proteins associated with chromatin remodeling and manipulation. The domain is highly conserved among both plants and animals and is found in a large variety of proteins from many genomes. CHD9 acts as a transcriptional coactivator for PPARα and may also be an ATP-dependent chromatin remodeling protein. CHD9 is widely expressed at low levels and is present as three isoforms produced by alternative splicing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: alternatively spliced; ATP-dependent chromatin remodeler CHD9; ATP-dependent helicase CHD9; BC022889; CHD-9; chromatin remodeling factor CHROM1; Chromatin-related mesenchymal modulator; Chromatin-remodeling factor CHROM1; Chromo domain-containing protein 9; chromodomain helicase; ciprofibrate bound protein p240; CReMM; DNA-helicase; FLJ12178; helicase chromatin remodeling factor; KIAA0308; Kismet homolog 2; Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; PPAR-alpha-interacting complex protein 320 kDa; PPAR{gamma}-interacting cofactor 320 kDa; proteinx0008; unnamed protein product
Gene Aliases: AD-013; AD013; CHD-9; CHD9; CReMM; KIAA0308; KISH2; PRIC320; x0008
UniProt ID: (Human) Q3L8U1
Entrez Gene ID: (Human) 80205
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support