Search
Invitrogen
Human DRAK2 (aa 2-42) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-109796
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145039. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
STK17B (also known as DRAK2) is a member of the serine/threonine kinase family and is related to death-associated protein kinase that triggers apoptosis. STK17B is selectively important for T-cell survival and inhibition of STK17B has therapeutic potential for autoimmune disease. T-cell survival depends on a balance of T-cell receptor and co-stimulatory signals and deficiency of STK17B can affect autoimmune disease susceptibility without generalized suppression of the immune system. Protein kinases play important roles in the signal transduction in response to a variety of external stimuli. Recently, several protein kinases have been identified that may also be involved in apoptotic process. Overexpression of a serine/threonine kinase, ZIP kinase can cause the morphological changes typical of apoptosis in NIH 3T3 cells. Sanjo et al, have identified two new protein kinases DRAK1 and DRAK2 (Death Receptor Associated Kinase 1 and 2). Both DRAKs and ZIP kinase share significant homology at the amino acid level. The kinase domains of both DRAKs, ZIP kinase are homologous to DAP (Death-associated protein) kinase, which is involved in the apoptotic signaling induced by interferon-g. Overexpression of DRAKs in NIH 3T3 cells lead to apoptosis. These transfection experiments suggest that C-terminal domain of DRAKs are important for induction of apoptosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DAP kinase-related apoptosis-inducing protein kinase 2; death-associated protein kinase-related 2; DRAK 2; Serine/threonine-protein kinase 17B; ST17B; STK 17B; STK17B; unnamed protein product
Gene Aliases: DRAK2; STK17B
UniProt ID: (Human) O94768
Entrez Gene ID: (Human) 9262
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support