Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SLC22A17 (aa 241-300) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89025
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51735. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The Slc22 family of organic anion and cation transporters (OATs, OCTs, OCTNs) are transmembrane proteins expressed predominantly in kidney and liver. Each contain 12 predicted alpha-helical transmembrane domains (TMDs) and one large extracellular loop between TMDs 1 and 2. Transporters of the SLC22 family function in different ways such as uniporters that mediate facilitated diffusion in either direction (OCTs), as anion exchangers (OAT1, OAT3 and URAT1), and as Na(+)/l-carnitine cotransporter (OCTN2). Slc22 family members participate in the absorption and/or excretion of drugs, xenobiotics, and endogenous compounds in intestine, liver, and kidney, and perform homeostatic functions in brain and heart. Mutations in the Slc22 family may cause specific diseases such as primary systemic carnitine deficiency or idiopathic renal hypouricemia and may change drug absorption or excretion. Recent studies show the expression of Slc22A17 as receptor for Lipocalin 2 is relatively high in hematopoietic stem cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 24p3 receptor; 24p3R; Brain-type organic cation transporter; Lipocalin-2 receptor; Neutrophil gelatinase-associated lipocalin receptor; NGAL receptor; NgalR; potent brain type organic ion transporter; solute carrier family 22 (organic cation transporter), member 17; Solute carrier family 22 member 17; solute carrier family 22, member 17
Gene Aliases: 24p3R; BOCT; BOIT; hBOIT; NGALR; NGALR2; NGALR3; SLC22A17
UniProt ID: (Human) Q8WUG5
Entrez Gene ID: (Human) 51310
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support