Search
Invitrogen
Human TAF5 (aa 332-449) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-89361
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
IVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52300. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TFIID is a general transcription factor which initiates preinitiation complex assembly through direct interaction with the TATA promoter element. It is a multisubunit complex consisting of a small TATA-binding polypeptide andother TATA-binding protein (TBP)-associated factors (TAFs). Although native TFIID can mediate both activator-independent (basal) and activator-dependent transcription in reconstituted systems, TBP can mediate only basal transcription. TAF II p100 (TBP-associated factor II100), also known as TAF5 or TAFII100, is the third largest subunit of human TFIID. It contains six WD40 repeats at the C-terminus and has an N-terminus capable of forming a flexible dimer. TAF II p100 plays an important role in forming the scaffold that is crucial for the assembly of the TFIID complex. TAF II p100 may also be involved in the stabilization of TAF interactions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: TAF(II)100; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TATA box binding protein (TBP)-associated factor 2D; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; transcription initiation factor TFIID 100 kD subunit; Transcription initiation factor TFIID 100 kDa subunit; Transcription initiation factor TFIID subunit 5; unnamed protein product
Gene Aliases: TAF(II)100; TAF2D; TAF5; TAFII-100; TAFII100
UniProt ID: (Human) Q15542
Entrez Gene ID: (Human) 6877
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support