Search
Invitrogen
Human SLC6A15 (aa 10-69) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-89570
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15), also known as sodium-dependent neutral amino acid transporter B(0)AT2, transporter v7-3, NTT73 or sodium-coupled branched-chain amino-acid transporter 1 (SBAT1), is a 730 amino acid multi-pass membrane protein that acts as a sodium-dependent neutral amino acid transporter. A member of the sodium neurotransmitter symporter (SNF) family and SLC6A15 subfamily, SLC6A15 differs from other members of its family in that it does not appear to be chloride-dependent. SLC6A15 is expressed in brain and is encoded by a gene that maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4. 5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p, which causes facial developmental defects and seizure disorders.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: homolog of rat orphan transporter v7-3; orphan sodium- and chloride-dependent neurotransmitter transporter NTT73; orphan transporter v7-3; Sodium- and chloride-dependent neurotransmitter transporter NTT73; Sodium-coupled branched-chain amino-acid transporter 1; Sodium-dependent neutral amino acid transporter B(0)AT2; sodium/chloride dependent neurotransmitter transporter Homo sapiens orphan neurotransmitter transporter NTT7; solute carrier family 6 (neurotransmitter transporter), member 15; solute carrier family 6 (neutral amino acid transporter), member 15; Solute carrier family 6 member 15; Transporter v7-3; unnamed protein product
Gene Aliases: B0AT2; hv7-3; NTT73; SBAT1; SLC6A15; V7-3
UniProt ID: (Human) Q9H2J7
Entrez Gene ID: (Human) 55117
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support