Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FCRL1 (aa 75-164) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-90383
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53038. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Fc receptor-like 1 (FCRL1) is a gene situated on chromosome 1q23, encoding a protein that is part of the Fc receptor-like family, which shares structural similarities with classical Fc receptors involved in immune responses. FCRL1 is predominantly expressed in B lymphocytes and is thought to play a role in the regulation of immune functions, particularly those associated with B cell development and differentiation. Although its precise biological function is not fully understood, it is believed to act as an immunomodulatory receptor that could influence B cell signaling pathways. The expression patterns of FCRL1 suggest possible involvement in autoimmune disorders and immune system modulation, potentially contributing to pathological conditions when dysregulated. Research into FCRL1 and other Fc receptor-like proteins continues to explore their contributions to immune homeostasis and potential as therapeutic targets in diseases involving B cell dysfunction.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD307a; CD307a antigen; Fc receptor homolog 1; Fc receptor-like 1; Fc receptor-like protein 1; FcR-like protein 1; FcRH1; FCRH1DKFZp667O1421; hIFGP1; IFGP family protein 1; Immune receptor translocation-associated protein 5; immunoglobulin superfamily Fc receptor, gp42
Gene Aliases: CD307a; FCRH1; FCRL1; IFGP1; IRTA5
UniProt ID: (Human) Q96LA6
Entrez Gene ID: (Human) 115350
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support