Search
Invitrogen
Human Nectin 3 (aa 94-220) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-90495
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Nectin-3 is a 83 kDa type I transmembrane glycoprotein. Nectin, originally isolated as poliovirus receptor-related protein (PRR), is a cell-cell adhesion molecule of the immunoglobulin supergene family. Nectins are calciumindependent immunoglobulin-like cell-cell adhesion molecules consisting of four members, nectin 1-4. Nectins homophilically and heterophilically trans-interact to form a variety of cell-cell junctions, including cadherin-based adherens junctions in epithelial cells and fibroblasts in culture, synaptic junctions in neurons, and Sertoli cell-spermatid junctions in testis, in cooperation with, or independently of, cadherins. Both nectin-2 and nectin-3 are ubiquitously expressed, whereas nectin-1 is abundantly expressed in brain. Nectin-2 and -3 are expressed in cells where cadherin is not expressed, such as blood cells and spermatids. All members of the nectin family have two or three splice variants. For nectin-3, three isoforms exist: nectin-3 alpha, -3 beta and -3 gamma, of which nectin-3 alpha is the largest. Nectin-3, also known as PRR3, is a transmembrane protein that is predominantly expressed in testis and placental tissues as well in many cell lines. Nectin interacts in vivo with both long and short isoforms of afadin, an actin binding protein, at cadherin-based cell-cell adherence junctions in various tissues and cell lines. Furthermore, the ectodomains of nectin-3 and CD155 (Poliovirus Receptor) have shown strong affinity to each other. Injection of antibody 103-A1 into lumen of seminiferous tubules leads to disruption of the actin filaments in Sertoli cells at the Sertoli-maturing spermatid ectoplasmic specialization and exfoliation of maturing spermatids form the seminiferous epithelium.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD113; CDw113; DKFZP566B0846; FLJ90624; nectin 3; Nectin cell adhesion molecule 3; Nectin-3; poliovirus receptor-related 3; Poliovirus receptor-related protein 3; unnamed protein product
Gene Aliases: CD113; CDW113; NECTIN-3; NECTIN3; PPR3; PRR3; PVRL3; PVRR3
UniProt ID: (Human) Q9NQS3
Entrez Gene ID: (Human) 25945
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support