Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human MOV10L1 (aa 599-698) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-92345
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53898. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Isoform 1: ATP-dependent RNA helicase required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for germline integrity (PubMed:20534472, PubMed:20547853, PubMed:23166510, PubMed:25762440). Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons (PubMed:20534472, PubMed:20547853, PubMed:23166510, PubMed:25762440). Involved in the primary piRNA metabolic process (PubMed:20534472, PubMed:20547853, PubMed:23166510, PubMed:25762440). Specifically binds to piRNA precursors and promotes the generation of intermediate piRNA processing fragments that are subsequently loaded to Piwi proteins (PubMed:25762440). Acts via its ATP-dependent RNA helicase activity: displays 5'-3' RNA unwinding activity and probably mediates unwinding and funneling of single-stranded piRNA precursor transcripts to the endonuclease that catalyzes the first cleavage step of piRNA processing to generate piRNA intermediate fragments that are subsequently loaded to Piwi proteins (PubMed:25762440). {ECO:0000269; PubMed:20534472, ECO:0000269; PubMed:20547853, ECO:0000269; PubMed:23166510, ECO:0000269; PubMed:25762440}.; Isoform 2: May act downstream of MEF2C during heart formation. Acts as a cardiac-specific suppressor of cardiomyocyte hypertrophy and cell cycle progression, suggesting that it may suppress these processes through the regulation of CDKN1A. Such results however require additional evidence. {ECO:0000305; PubMed:11854500}.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: cardiac helicase activated by MEF2C protein; Moloney leukemia virus 10-like protein 1; Mov10-like 1; MOV10-like protein 1; Mov10l1, Moloney leukemia virus 10-like 1, homolog; putative helicase Mov10l1; RNA helicase Mov10l1
Gene Aliases: CHAMP; DJ402G11.8; MOV10L1
UniProt ID: (Human) Q9BXT6
Entrez Gene ID: (Human) 54456
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support