Search
Invitrogen
Human ABCA5 (aa 54-127) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-93359
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ABCA5 (ATP-binding cassette, sub-family A (ABC1), member 5) is a 1,642 amino acid protein belonging to the ABC transporter superfamily and the ABCA family. The ABC1 subfamily is the only major ABC subfamily exclusive to multicellular eukaryotes. Ubiquitously expressed, with high expression in testis, skeletal muscle, kidney, liver and placenta, ABCA5 is a multi-pass membrane protein that contains two ABC transporter domains and exists as three alternatively spliced isoforms. ABCA5 exhibits membrane subcellular localization and may play a role in processing autolysosomes. Spanning 80 kb, ABCA5 contains 39 exons, with exon 2 containing the putative translation start site. ABCA5 is the first of five ABC1 family members that maps to human chromosome 17q24. ABCA5 is linked to lysosomal diseases and may play a role in tumor development and cardiomyocyte and follicular cell activities. ABCA5 might also be a specific urine marker for diagnosis of patients with high-grade prostatic intraepithelial neoplasia (HGPIN).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-binding cassette A5; ATP-binding cassette sub-family A member 5; ATP-binding cassette, sub-family A (ABC1), member 5; Cholesterol transporter ABCA5; DKFZp451F117; DKFZp779N2435; FLJ16381
Gene Aliases: ABC13; ABCA5; EST90625; KIAA1888
UniProt ID: (Human) Q8WWZ7
Entrez Gene ID: (Human) 23461
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support