Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CADM3 (aa 84-225) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-94790
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Cell adhesion molecule 3 (CADM3), also known as Necl-1, is a gene located on chromosome 1p36.22, encoding a protein that is part of the immunoglobulin superfamily involved in cell-cell adhesion processes. CADM3 is predominantly expressed in the nervous system, particularly in regions such as the brain and spinal cord, where it plays crucial roles in neuronal communication, synapse formation, and maintenance of neural network architecture. The protein functions by mediating homophilic and heterophilic interactions with other cell adhesion molecules, facilitating synapse stabilization and neuronal differentiation. CADM3's activity is essential for proper neural development and function, and dysregulation of its expression has been linked to various neurological disorders. Beyond its role in the nervous system, CADM3 also contributes to tumor suppression in certain cancers, as its expression is often downregulated in tumor tissues. Research into CADM3 continues to explore its potential as a therapeutic target in both neurobiology and oncology.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Brain immunoglobulin receptor; Cell adhesion molecule 3; dendritic cell nectin-like protein 1 short isoform; IgSF4B; Immunoglobulin superfamily member 4B; immunoglobulin superfamily, member 4B; NECL-1; nectin-like 1; Nectin-like protein 1; Synaptic cell adhesion molecule 3; SynCAM3; TSLC1-like 1; TSLC1-like protein 1; TSLL1
Gene Aliases: BIgR; CADM3; IGSF4B; Necl-1; NECL1; SYNCAM3; TSLL1; UNQ225/PRO258
UniProt ID: (Human) Q8N126
Entrez Gene ID: (Human) 57863
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support