Search
Invitrogen
Human AGO2 (aa 18-49) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-106814
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
1.40 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66129. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Ago proteins are broadly expressed in somatic cells, associate with miRNAs and are key actors in different RNA silencing pathways. However, only the Ago2 protein displays endonucleolytic or 'Slicer' activity and can therefore execute miRNA-directed cleavage of target mRNA, provided that the base-pairing between the Ago2-associated miRNA and the mRNA sequence is perfect. In case of partial complementarity, the Ago2 protein fails to cleave, but instead interferes with translation of the target mRNA via its translational repression activity. Ago2 has been shown to play a non-redundant role in small RNA guided gene silencing processes, including RNA interference, translation repression and heterochromatinization. As a core element of the RISC complex, AGO2 initiates the degradation of target mRNAs through its catalytic activity in gene silencing processes guided by siRNAs or miRNAs. In addition to mRNA degradation or gene silencing guided by miRNAs, Ago2 also acts as a RNA slicer in a Dicer-independent way, as well as a regulator of miRNA maturation. Over-expression of Ago2 has been correlated with several aspects of cancers, including tumor cell growth and the overall survival of cancer patients. Furthermore, gene disruption in the mouse demonstrated that the Ago2 protein is essential for embryonic development and a key regulator of B-lymphoid and erythroid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AGO1; argonaute 2, RISC catalytic component; Argonaute RISC catalytic component 2; Argonaute1; Argonaute2; cancer susceptibility candidate 7 (non-protein coding); eIF-2C 1; eIF-2C 2; eIF2C; eIF2C 1; EIF2C1; Eukaryotic translation initiation factor 2C 2; eukaryotic translation initiation factor 2C, 2; hAgo1; long intergenic non-protein coding RNA 980; PAZ Piwi domain protein; PPD; Protein argonaute-1; Protein argonaute-2; Protein slicer
Gene Aliases: AGO2; CASC7; EIF2C2; LESKRES; LINC00980; PPD; Q10
UniProt ID: (Human) Q9UKV8
Entrez Gene ID: (Human) 27161
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support