Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human AGPAT2 (aa 211-273) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-91098
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Lysophospholipid acyltransferases (LPLATs) catalyse the addition of fatty acyl moieties to the glycerol backbone of lysophospholipids. In addition to playing a crutial role in the synthesis of structural membrane components the LPLATs are also implicated in cellular signalling responses for cytokines, growth factors and other agonists. Cellular signalling through the interleukin 1 receptor in human mesangial cells and EL-4 cells proceeds by the activation of lysophosphatidic acid acyltransferase (LPAAT). Activation of LPAAT by interleukin 1 results in the generation of unsaturated phosphatidic acid species, that are crucial to the generation of diacylglycerol and interleukin 1 signalling. LPLATs are also involved in signalling for increased interleukin 2 synthesis through the T cell antigen receptor. Activation of T-cells via anti-CD3 stimulation has been shown to increase incorporation of polyunsaturated fatty acids intophosphatidylcholine via lysophosphatidylcholine acyltransferase.Activation of this enzyme is essential for the sustained activationand translocation of protein kinase C.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); 1-AGP acyltransferase 2; 1-AGPAT 2; LPAAT-beta; Lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; testicular tissue protein Li 143
Gene Aliases: 1-AGPAT2; AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
UniProt ID: (Human) O15120
Entrez Gene ID: (Human) 10555
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support