Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ALKBH2 (aa 173-255) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-106087
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The E. coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA; ALKBH2 and ALKBH3 are mammalian homologs of AlkB that catalyze the removal of 1-methyladenine and 3-methylcytosine, modifications that left unchecked could lead to cancerous cells. Mutations in both ALKBH2 and ALKBH3 have been observed in pediatric brain tumors indicating that these proteins are important in the prevention of cancer formation. Like the histone demethylase JMJD1A, ALKBH2 is a non-heme iron enzyme that is inhibited by Nickel ions, suggesting that inhibition of ALKBH2 by Nickel ions may play a role in the development of cancer. Conversely, ALKBH2 mRNA and protein levels are increased glioma cells following Photofrin-mediated photodynamic therapy, an adjuvant therapy in cancer treatment, suggesting that down-regulating ALKBH2 expression in cancer cells may enhance the anti-cancer effectiveness of this treatment.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 2OG-Fe(II) oxy DC1; alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase; alkB, alkylation repair homolog 2; Alkylated DNA repair protein alkB homolog 2; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2; DNA oxidative demethylase ALKBH2; Oxy DC1
Gene Aliases: ABH2; ALKBH2
UniProt ID: (Human) Q6NS38
Entrez Gene ID: (Human) 121642
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support