Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD18 (aa 25-140) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-88640
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
5.50 mg/mL
Purification
Metal-chelate chromatography
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82368. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD18, also known as the integrin beta 2 subunit, is a 90-95 kDa type I transmembrane protein expressed on all leukocytes. It heterodimerizes with the alpha chains of CD11a, CD11b, CD11c, and CD11d to form various leukocyte (beta2) integrins, which are crucial for cellular adhesion and signaling. The CD18/CD11a complex, known as lymphocyte function-associated antigen-1 (LFA-1), plays a significant role in cellular adhesion and inflammatory reactions. CD18 also forms heterodimers with CD11b (Mac-1, CR3), CD11c, and CD11d, contributing to the processes of cell adhesion and cell-surface mediated signaling. These integrins are essential for proper leukocyte migration and mediating intercellular contacts. The absence of CD18 leads to leukocyte adhesion deficiency type I (LAD1), a condition characterized by impaired leukocyte migration. Severe reduction in CD18 expression can result in the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin, which can mediate leukotoxin-induced cytolysis. Defects in the CD18 gene are the cause of LAD1, and two transcript variants encoding the CD18 protein have been identified. The integrin-mediated responses are often a composite of the functions of its individual subunits, highlighting the importance of CD18 in immune function and disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD18; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; Complement receptor C3 subunit beta; integrin beta chain, beta 2; Integrin beta-2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C
Gene Aliases: CD18; ITGB2; LAD; LCAMB; LFA-1; MAC-1; MF17; MFI7
UniProt ID: (Human) P05107
Entrez Gene ID: (Human) 3689
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support