Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD41 (aa 523-615) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-95249
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83185. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD41, also known as platelet glycoprotein IIb or ITGA2B, is a protein composed of two subunits: a 120 kDa alpha subunit and a 23 kDa beta subunit. It interacts with CD61 (gpIIIa, integrin beta III) in the presence of calcium to form a functional adhesive protein receptor. Initially thought to be expressed exclusively on platelets and megakaryocytes, CD41 is also found on hematopoietic progenitors in the embryo, fetus, and adult, indicating its role in early stages of hematopoietic differentiation. CD41 plays a crucial role in platelet function and blood coagulation by mediating platelet aggregation. Upon blood vessel damage, CD41 binds to various adhesion molecules, including von Willebrand factor, fibrinogen, fibronectin, and vitronectin, facilitating platelet adhesion and aggregation. This receptor is essential for platelet function, contributing to the binding of several adhesion molecules and playing a significant role in hemostasis. Diseases associated with CD41 dysfunction include Glanzmann Thrombasthenia and Platelet type-16 bleeding disorder, highlighting its importance in normal platelet function and blood coagulation processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: alphaIIb protein; CD41; form 1; form 2; GPalpha IIb; GPIIb; Integrin alpha-IIb; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet-specific antigen BAK; protein phosphatase 1, regulatory subunit 93
Gene Aliases: BDPLT16; BDPLT2; CD41; CD41B; GP2B; GPIIb; GT; GTA; HPA3; ITGA2B; ITGAB; PPP1R93
UniProt ID: (Human) P08514
Entrez Gene ID: (Human) 3674
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support