Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD48 (aa 99-161) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-106607
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD48, also known as Blast-1, is a 45 kDa glycoprotein that is part of the SLAM and Ig superfamilies. It is a GPI-anchored protein broadly expressed on most hematopoietic cells, including lymphocytes and monocytes, but is weakly expressed on granulocytes and absent on platelets, fibroblasts, epithelium, and endothelium. CD48 plays a critical role in adhesion and T cell activation, serving as a high-affinity ligand for 2B4 and a low-affinity ligand for CD2. The interaction between 2B4 and CD48 among NK and NK-T cells regulates cell proliferation. CD48 is involved in eosinophil activation and its expression increases in several infectious diseases. It is also a marker for detecting defects in the GPI anchoring structure in patients with paroxysmal nocturnal hemoglobulinuria (PNH). Recent studies have highlighted the differential expression of SLAM family members, including CD48, CD150, and CD244, among bone marrow hematopoietic progenitors. This provides a useful tool for predicting the primitiveness of hematopoietic progenitors: hematopoietic stem cells (HSCs) are CD150(+)CD244(-)CD48(-), non-self-renewing multipotent progenitors (MPPs) are CD244(+)CD150(-)CD48(-), and the most restricted progenitors are CD48(+)CD244(+)CD150(-). Additionally, the 2B4-CD48 interaction may be involved in the pathology of allergic airway diseases, offering a potential pharmacological target for treating conditions like allergic rhinitis and asthma.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: B-cell activation marker; B-lymphocyte activation marker BLAST-1; BCM1 surface antigen; CD48; CD48 antigen; CD48 antigen (B cell membrane protein); CD48 antigen (B-cell membrane protein); CD48d; Leukocyte antigen MEM-102; sCD 48; sCD48; Signaling lymphocytic activation molecule 2; Signaling lymphocytic activation molecule 2 (SLAMF2); SLAM family member 2; SLAMF2; soluble CD 48; soluble CD48; TCT.1
Gene Aliases: BCM1; BLAST; BLAST1; CD48; hCD48; mCD48; MEM-102; SLAMF2
UniProt ID: (Human) P09326
Entrez Gene ID: (Human) 962
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support