Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD55 (aa 224-378) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-95416
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82005. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD55 (decay-accelerating factor, DAF) is a GPI-anchored membrane glycoprotein that protects autologous cells from classical and alternative pathway of complement cascade. Bidirectional interactions between CD55 and CD97 are involved in T cell regulation and CD55 can regulate complement when bound to CD97. In tumors, CD55 promotes neoangiogenesis, tumorigenesis, invasiveness and evasion of apoptosis. CD55 is a 70 kDa glycoprotein (in erythrocytes) anchored in the membrane by glycosylphosphatidylinositol tail. In other cells, the apparent molecular weight is somewhat larger for CD55 and has a substantial content of O-glycans. CD55 binds to activated C4b or C3b complement fragments on the cell surface, preventing the assembly and accelerating the decay of both classical and alternative pathways. CD55 carries the Cromer related blood group antigens. Two alternatively spliced transcripts encoding CD55 have been identified, and the predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. CD55 has been studied to have a role in prostate cancer growth and survival.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD55; CD55 antigen; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Complement decay-accelerating factor; RP11-357P18.1
Gene Aliases: CD55; CR; CROM; DAF; TC
UniProt ID: (Human) P08174
Entrez Gene ID: (Human) 1604
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support