Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-100950
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLD
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55462. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The COP9 signalosome (CSN) complex is involved in several different developmental and cellular processes. The complex is made up of several widely expressed proteins: CSN1 (COPS1), CSN2 (COPS2), CSN3 (COPS3), CSN4 (COPS4), CSN5 (COPS5), CSN6 (COP6), CSN7a (COPS7, COPS7a) or CSN7b (COP7b) and CSN8 (COP8). The CSN complex acts as a regulator for the ubiquitin conjugation pathway by mediating the deneddylation of the SCF-type E3 ligase complexes, which leads to a decrease in ubiquitin ligase activity of SCF-complexes. It is also involved in the phosphorylation of p53, c-Jun, I B-alpha and IRF-8, as well as CSN-dependent phosphorylation of p53, and c-Jun protects and promotes degradation by the Ubl system. CSN7 is phosphorylated by CK2 and is composed of two subunits; a and b. CSN7a contains a PCI (Proteasome CSN9 initiation factor 3) region, as well as a coiled-coil region and is predicted to interact with CSN2, CSN3, CSN4, CSN5, CSN6, CSN8, and GPS1. CSN7b contains only a PCI region and is predicted to interact with INT6.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A; COP9 signalosome complex subunit 7a; Dermal papilla-derived protein 10; JAB1-containing signalosome subunit 7a; SGN7a
Gene Aliases: COPS7A; CSN7; CSN7A; DERP10; SGN7a
UniProt ID: (Human) Q9UBW8
Entrez Gene ID: (Human) 50813
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support