Search
Invitrogen
Human KCNE1L (aa 1-59) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-92243
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59946. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Kcne1 is a member of Voltage-gated potassium (Kv) channels that represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. The diverse functions of Kv channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The Kcne1 gene encodes a membrane protein which has sequence similarity to the KCNE1 gene product, a member of the potassium channel, voltage-gated, isk-related subfamily. Kcne1, an intronless gene is deleted in AMME contiguous gene syndrome and may be involved in the cardiac and neurologic abnormalities found in the AMME contiguous gene syndrome. Functionally, Kcne1 is a potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Kcne1 also functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1. Diseases associated with KCNE1 include Jervell And Lange-Nielsen Syndrome 2 and Long Qt Syndrome 5.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AMME syndrome candidate gene 2 protein; AMMECR2 protein; cardiac voltage-gated potassium channel accessory subunit 5; KCNE1-like; KCNE1L; minK-related peptide 4 (MiRP4); Potassium channel subunit beta MiRP4; Potassium voltage-gated channel subfamily E member 1-like protein; Potassium voltage-gated channel subfamily E regulatory beta subunit 5; potassium voltage-gated channel, Isk-related family, member 1-like; unnamed protein product
Gene Aliases: AMMECR2; KCNE1L; KCNE5
UniProt ID: (Human) Q9UJ90
Entrez Gene ID: (Human) 23630
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support