Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human LSR (aa 318-402) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-109469
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Lipolysis-stimulated lipoprotein receptor (LSR), encoded by the LSR gene, is a crucial component in lipid metabolism, particularly involved in the endocytosis of triglyceride-rich lipoproteins. It is typically expressed in liver and adipose tissues, playing a pivotal role in maintaining lipid and glucose homeostasis. LSR binds to lipoproteins in the presence of free fatty acids, facilitating the uptake and clearance of lipids from the bloodstream, which is significant in preventing atherosclerosis and other lipid-related disorders. The protein functions as a multi-subunit complex, which includes two isoforms, LSRα and LSRβ, each contributing to lipoprotein metabolism. Research has highlighted its involvement in metabolic processes and its potential impacts on obesity and insulin resistance. LSR has also been studied in the context of hepatic lipid accumulation, where its downregulation is associated with increased lipid deposition in the liver, suggesting its importance in preventing non-alcoholic fatty liver disease (NAFLD). Due to its central role in lipid metabolism, LSR has emerged as a potential therapeutic target for metabolic diseases and cardiovascular conditions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Angulin-1; immunoglobulin-like domain containing receptor 3; Lipolysis-stimulated lipoprotein receptor; lipolysis-stimulated remnant; LISCH protein; liver-specific bHLH-Zip transcription factor
Gene Aliases: ILDR3; LISCH; LISCH7; LSR
UniProt ID: (Human) Q86X29
Entrez Gene ID: (Human) 51599
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support