ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Wet ice

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Sin1 was initially identified as the human homolog of S. pombe SIN1. Recent evidence has shown that it identical to Mip1, a protein that interacts with MEKK2, a member of the mitogen-activated protein kinase (MAPK) intracellular signaling network. MAPKAP1 is thought to prevent MEKK2 activation and dimerization by forming a complex with the inactive and non-phosphorylated MEKK2, thereby blocking the JNK1/2, ERK1/2, p38 and ERK5 MAPKs. MAPKAP1 has also been shown to play a role in the TOR signaling process, a pathway that is involved in controlling cell growth and proliferation in response to environmental cues such as nutrients, growth factors and hormones. Experiments showed that MAPKAP1 helped to maintain the TOR/rictor assembly but not the TOR/RAPTOR complex, which allowed specific phosphorylation of Akt, a kinase that is believed to couple the growth factor-PI3K signaling pathway to the nutrient-regulated TOR signaling pathway. Multiple alternatively spliced isoforms of MAPKAP1 have been identified.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: MEKK2-interacting protein 1; MGC2745; Mip1a; Mip1b; Mip1r; MIP1SIN1SIN1b; Mitogen-activated protein kinase 2-associated protein 1; mitogen-activated protein kinase associated protein 1; mitogen-activated protein kinase-associated protein 1; MAPKAP1; mSIN1; ras inhibitor MGC2745; RP11-269P11.1; SAPK-interacting protein 1; SIN1; SIN1a; SIN1b; SIN1g; stress-activated map kinase interacting protein 1; Stress-activated map kinase-interacting protein 1; stress-activated protein kinase-interacting 1; Target of rapamycin complex 2 subunit MAPKAP1; TORC2 subunit MAPKAP1; unnamed protein product

Human MAPKAP1 (aa 372-521) Control Fragment Recombinant Protein

Product Details

RP-89608

Neutralization (Neu)

Species

Expression System

Amino acid sequence

Tag