Search
Invitrogen
Human MLLT10 (aa 356-504) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102473
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82215. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Translocations affecting chromosome 11q23 involve many partner chromosome regions and occur in various leukemias. The 11q23 gene involved in the translocations is MLL. MLLT10 is the partner gene to MLL1 involved in t(10;11)(p12;q23) translocations. In an analysis of two leukemia patients, the in t(10;11)(p12;q23) translocation fuses MLL1, a SET domain containg histone methyltransferase, to the MLLT10 gene. The MLLT10 gene encodes a predicted 1,027-amino acid protein containing an N-terminal zinc finger and a C-terminal leucine zipper domain. The MLLT10 gene is one of the few MLL partner genes to be independently rearranged with a third gene in leukemia, the CALM gene in the t(10;11)(p12;q14) translocation. Chimeric fusion proteins MLL/AF10 and CALM/AF10 consistently retain the leucine zipper motif of MLLT10. The leucine zipper interacts with GAS41, a protein previously identified as the product of an amplified gene in a glioblastoma. GAS41 interacts with integrase interactor-1 (INI1), a component of the SWI/SNF complex, which acts to remodel chromatin and to modulate transcription. Retention of the leucine zipper in the MLL and CALM fusions suggested that a key feature of these chimeric proteins may be their ability to interfere in normal gene regulation through interaction with the adenosine triphosphate-dependent chromatin remodeling complexes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: af-10; ALL1-fused gene from chromosome 10 protein; DKFZp686E10210; MGC75086; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10; Protein AF-10; type I AF10 protein; type III AF10 protein; type IV AF10 protein; unnamed protein product
Gene Aliases: AF10; MLLT10
UniProt ID: (Human) P55197
Entrez Gene ID: (Human) 8028
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support