Search
Invitrogen
Human NALP4 (aa 701-792) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-109015
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139855. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
NALP proteins include the apoptosis regulator APAF1 (apoptotic protease activating factor 1) and mammalian NOD-LRR proteins and are thought to be involved in inflammation and reproduction. NALP4, also known as PYRIN-containing APAF1-like protein 4, has a C-terminal leucine-rich repeat (LRR) region, an N-terminal Pyrin domain (PYD) followed by a NACHT domain, and a NACHT-associated domain. In transfected 293 cells, NALP4 suppressed NF-kappa-B induction by TNF-a and IL-1-b, suggesting NALP4 operates at a point of convergence in these two signaling pathways. NALP4 also suppressed NF-kappa-B induction resulting from overexpression of several adapter proteins and protein kinases involved in these pathways, including TRAF2, TRAF6, RIP, and IRAK2, as well as the IKK-alpha and IKK-beta, suggesting that NALP4 is critical in modulating NF-kappa-B activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Cancer/testis antigen 58; CT58; NACHT, leucine rich repeat and PYD containing 4; NACHT, LRR and PYD domains-containing protein 4; novel member of the NALP family; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 4; PAAD and NACHT-containing protein 2; PAN2; PYPAF4; PYRIN and NACHT-containing protein 2; PYRIN-containing APAF1-like protein 4; Ribonuclease inhibitor 2; unnamed protein product
Gene Aliases: CLR19.5; CT58; NALP4; NLRP4; PAN2; PYPAF4; RNH2
UniProt ID: (Human) Q96MN2
Entrez Gene ID: (Human) 147945
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support